PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010518911.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 414aa    MW: 46534.6 Da    PI: 8.6782
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010518911.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32235288255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010518911.1 235 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 288
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15232288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28233288IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-23235288IPR006447Myb domain, plants
PfamPF002492.8E-7236287IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPDGK PSSTWQRRST GETDDQDLDL GFWRRALDSR TSSLVSSNSK  60
ADTSFDLSLS NNSSFFPRSP VSVSSTEPNS LAHFHFLPNC NGSNILNSLQ FQTAQQQLFQ  120
EQQQLQYQRH GFLSRDLSFL RPIRGIPLYQ NPPPPPPPPP CFPFDPSSLI PSSSSSSLVN  180
NTISTSSVAN SGLTDPNHNP NNRHHHHRHH HQGLMNNNRS RFMPRFPAKR SMRAPRMRWT  240
TTLHARFVHA VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK TTDKAAASSG  300
QSDVYENGSS GDNSDDWMLD MNRKSKQRNE MQNQRDKSYG EKGKDHRGLW SNSSGEARLH  360
GMPNDTVAEN MLPYEKEMDP SYERISSEDR SSSSIISGTS PTKPNLEFTL GMPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010518911.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6161e-135KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2ZR211e-154A0A0D2ZR21_BRAOL; Uncharacterized protein
STRINGBra033844.1-P1e-145(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.16e-89G2-like family protein