PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010518853.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 286aa    MW: 32016 Da    PI: 9.9296
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010518853.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37e-332579155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  XP_010518853.1 25 KPRLRWTADLHDRFVDAVTRLGGADKATPKSVLKLMGLKGLTLYHLKSHLQKYRL 79
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.132282IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-322283IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-232580IPR006447Myb domain, plants
SuperFamilySSF466892.15E-162582IPR009057Homeodomain-like
PfamPF002491.3E-82778IPR001005SANT/Myb domain
PfamPF143793.1E-18128172IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MERMNLGGGG IGYENGGVVM TRDPKPRLRW TADLHDRFVD AVTRLGGADK ATPKSVLKLM  60
GLKGLTLYHL KSHLQKYRLG QQQAKKQNRA EHDTEKGGSS YVQFDRHSQG AFSNSSRIDG  120
LQRNIPFGES LRHQVEVRQR LQEQLEVQKK LQRRIEAQGK YLLALLDKAQ KSLPTYTNIP  180
SDEDATKGQS PYFNPKLSGL VEGNNGDEKN GKMDSITGFP NKSESEDFRV SKQKEKRETG  240
DGDDKTDPGL VNFDLNSKTG CDLITSGNFG VEMKMKPSVF ADRDIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010518853.10.0PREDICTED: probable transcription factor KAN2 isoform X2
SwissprotQ9SAK57e-47APL_ARATH; Myb family transcription factor APL
TrEMBLC0SVS41e-119C0SVS4_ARATH; Putative uncharacterized protein At5g45580 (Fragment)
STRINGfgenesh1_pg.C_scaffold_80002361e-119(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-99G2-like family protein