PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010518825.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family BES1
Protein Properties Length: 311aa    MW: 33988.1 Da    PI: 8.6967
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010518825.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222143.7e-6621421145
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp ++++++g s+sasp+ss+q
  XP_010518825.1   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWTVEEDGTTYRKGCKPVNRMDIIGGSTSASPCSSYQ 96 
                     5899******************************************************************************************* PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlsl 145
                             +sp++sy++sp+sssfpsp  +   s++++    +sl+p+l++ls+
  XP_010518825.1  97 --------PSPRASYNPSPSSSSFPSPRASHYPSSTNPfgdaNSLIPWLKNLSS 142
                     ........88999999999999999988877777766677779*******9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.7E-663141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCKEAG  60
WTVEEDGTTY RKGCKPVNRM DIIGGSTSAS PCSSYQPSPR ASYNPSPSSS SFPSPRASHY  120
PSSTNPFGDA NSLIPWLKNL SSNSPTKLPF FHGSSISAPV TPPLASPMAG SPTRCQVNIP  180
DSGWLSGMQT PQSGPSSPTF SLVSRNPFFE KEAFKARDCS PMWTPGQSGN CSPAIPAGAD  240
QTADVPMADG MAVEFAFGCN PRTTGLVKPW EGERIHEECA PDDLELTLGN SRTRCERREK  300
EKGENVAIEF F
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00444DAPTransfer from AT4G18890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010518825.10.0PREDICTED: BES1/BZR1 homolog protein 3 isoform X1
SwissprotO494041e-153BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLQ2HIR91e-152Q2HIR9_ARATH; At4g18890
STRINGAT4G18890.11e-151(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-147BES1/BZR1 homolog 3