PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG045438t1
Common NameTCM_045438
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 220aa    MW: 23844.2 Da    PI: 8.7998
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG045438t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.4e-42431421100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ae
  Thecc1EG045438t1  43 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAE 135
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l+++++e
  Thecc1EG045438t1 136 LNAVRAE 142
                       ***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81342143IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4243140IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKREAD VSSHHMGRRH MLGPPGTLNT ITPCAACKLL RRRCAQECPF  60
SPYFSPHEPQ KFASVHKVFG ASNVSKMLME VPESQRADAA NSLVYEANVR LRDPVYGCMG  120
AISALQQQVQ SLQAELNAVR AEILKYKCRE ANLIPSSHVA LLSSGAVSVA ALPSAPTHPP  180
PPPPPPPLPP TSSSSSMYTQ PTTAADYSTI SNENVSYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011230.11e-161LOB domain-containing protein 15
SwissprotQ8L5T52e-92LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A061FRT31e-161A0A061FRT3_THECC; LOB domain-containing protein 15
STRINGVIT_13s0067g02380.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-87LOB domain-containing protein 15
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]