PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG043357t1
Common NameTCM_043357
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 443aa    MW: 48996.8 Da    PI: 5.2579
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG043357t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.32.9e-53331601128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       l+pGfrFhPtdeelv++yLk+kv +k++++ ++i+evdiyk ePw+L   +++k++++ewyfFs  dkky +g r nrat++gyWkatgkd+e
  Thecc1EG043357t1  33 LAPGFRFHPTDEELVSYYLKRKVLNKPVRF-NAIAEVDIYKQEPWELSdkSRLKTRDQEWYFFSLLDKKYGNGARMNRATSQGYWKATGKDRE 124
                       579************************999.89**************85348899999*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v + +++l+g+kktLvf++grap+g +t+Wvmheyrl
  Thecc1EG043357t1 125 VRH-NSQLIGMKKTLVFHSGRAPDGLRTNWVMHEYRL 160
                       ***.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-6130183IPR003441NAC domain
PROSITE profilePS5100558.25233182IPR003441NAC domain
PfamPF023651.3E-2735160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MGREKNSLTV VPGPTAAAAA AAAAKTGGSA TALAPGFRFH PTDEELVSYY LKRKVLNKPV  60
RFNAIAEVDI YKQEPWELSD KSRLKTRDQE WYFFSLLDKK YGNGARMNRA TSQGYWKATG  120
KDREVRHNSQ LIGMKKTLVF HSGRAPDGLR TNWVMHEYRL VEEESERIGA LQGYVLCRVF  180
HKNNIGPPNG NRYAPFVEAE WDDGSAALIP GVDAVDDVVA ANDAVAGNDL AAAENGVQRI  240
DFEQDIQYAD EDSPPNDEVP RESLNERTDD CPPLPPCKIE RSDDCPPLCV LNREAPLPLL  300
QYKRRRHNDS GPNHANVSEN STRTTQDRCS STTTTAATAT TSPSSATTTA ISALLEFSLM  360
ESIEPKENPH VPPPTYDTAN LDSVVPPGCM KLINELQNEI HKISVDRETL KLEMMSAQAM  420
INILQSRIDS LSKENEDLKR SN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-473218419170NAC domain-containing protein 19
3swm_B9e-473218419170NAC domain-containing protein 19
3swm_C9e-473218419170NAC domain-containing protein 19
3swm_D9e-473218419170NAC domain-containing protein 19
3swp_A9e-473218419170NAC domain-containing protein 19
3swp_B9e-473218419170NAC domain-containing protein 19
3swp_C9e-473218419170NAC domain-containing protein 19
3swp_D9e-473218419170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007010047.20.0PREDICTED: NAC domain-containing protein 76
SwissprotQ9SQY01e-158NAC52_ARATH; NAC domain containing protein 52
TrEMBLA0A061FQ990.0A0A061FQ99_THECC; NAC domain protein, IPR003441
STRINGEOY188570.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-137NAC domain containing protein 50
Publications ? help Back to Top
  1. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  5. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  6. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]