PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG043081t1
Common NameTCM_043081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 221aa    MW: 23916.1 Da    PI: 6.7197
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG043081t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.25.2e-42671661100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q++ l+a+
  Thecc1EG043081t1  67 PCAACKILRRRCVEKCVLAPYFPPTEPYKFTIAHRVFGASNIIKSLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVSDLQAQ 159
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++e
  Thecc1EG043081t1 160 LAKTQAE 166
                       ***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.8566167IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-4267164IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MENNDKAAIS PISVSTPFSY SPSSSSSPPT PHYSPGFPSP NSQSNSPKNS HQPPPPPASP  60
PPVVLSPCAA CKILRRRCVE KCVLAPYFPP TEPYKFTIAH RVFGASNIIK SLQELPESQR  120
ADAVSSMVYE ASARIRDPVY GCAGAICQLQ KQVSDLQAQL AKTQAELVTM QCQQANLLAL  180
ICMEMTQSKE PTSQQQPYSI DTSCFLDDSN LASAWEPLWT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007009738.11e-160LOB domain-containing protein 1
SwissprotQ9LQR03e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A061FNS01e-160A0A061FNS0_THECC; LOB domain-containing protein 1
STRINGPOPTR_0008s04350.13e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-71LOB domain-containing protein 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]