PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042705t2
Common NameTCM_042705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 690aa    MW: 77448.3 Da    PI: 5.7542
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042705t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.31.4e-1103636861326
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL+ cA+av+s+d + a++lL+++++++sp gd mqR+a+yf+ +L+arla+s++++y al +++ts    +++l+a++lf  ++P+ k+
  Thecc1EG042705t2 363 LRTLLTLCAQAVASDDRRSANELLKQIRQHSSPMGDGMQRMAHYFVDGLEARLAGSGTQIYTALITKPTS---AADVLKAYHLFLAACPFRKL 452
                       5789**************************************************************9999...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s++  N++I++ +e++ r+HiiDf+i +G+QWp+L++ L+sRp+gpp+lRiTg++ p++g   +e++eetg rLa++Ae+++vpfef++ +a+
  Thecc1EG042705t2 453 SNFFSNKTIMNLAENAPRLHIIDFGILYGFQWPCLIRRLSSRPGGPPKLRITGIDLPQPGfrPAERVEETGLRLANYAETFKVPFEFHA-IAQ 544
                       ***********************************************************9*****************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       +++++++e+Lr++++E+l+Vn++++l +llde+v +es+r++vL+l+++++P+v+++   +  +n++ F +rf eal +ys+lfd+le+++pr
  Thecc1EG042705t2 545 KWDTIQIEDLRIDSDEVLVVNCMYRLRNLLDETVVVESPRNKVLNLIRKMNPDVFILGIVNGACNAPFFITRFREALFHYSTLFDMLETNVPR 637
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                       e  er+ +Ere++g+e++nv+acegaer+er et+++W+ r+++aG+++
  Thecc1EG042705t2 638 EIPERMLIEREIFGWEAMNVIACEGAERIERLETYKQWQVRISRAGLRQ 686
                       **********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.736337689IPR005202Transcription factor GRAS
PfamPF035144.9E-108363686IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MDRSLKGLYG SVDRFRLNDD TVLAFSGRNF DDGFQKETYV DIPPLQPAPM PRNLVPSSSV  60
NEEGDSHEDY DFSDVVLKYI NQMLMEEDME DKTCMFKESS AALQAAEKSF YEVLGQRYPH  120
SPKYELKPFT DQNQESFDDS HDQSCWRCSS ASISSSSSNL VDLGCSHDLG EQRSSSFASQ  180
ANSQSSHSSG NSTGSVLDGF VDSPVSTLRL PEIFSDSESA MQFRKGFEEA SRFLPNGQSL  240
FVDVESDGLF LKEVKEEAKG VVDKAEKNEF SQNGSRGKKN PYPEDVNLES GRSNKQSAVY  300
TGSTVSSEMF DKVLLNCQSV TDLRKALQDE TSKNVQQSGQ LKGSTGGKAR GKKQGSKRNV  360
VDLRTLLTLC AQAVASDDRR SANELLKQIR QHSSPMGDGM QRMAHYFVDG LEARLAGSGT  420
QIYTALITKP TSAADVLKAY HLFLAACPFR KLSNFFSNKT IMNLAENAPR LHIIDFGILY  480
GFQWPCLIRR LSSRPGGPPK LRITGIDLPQ PGFRPAERVE ETGLRLANYA ETFKVPFEFH  540
AIAQKWDTIQ IEDLRIDSDE VLVVNCMYRL RNLLDETVVV ESPRNKVLNL IRKMNPDVFI  600
LGIVNGACNA PFFITRFREA LFHYSTLFDM LETNVPREIP ERMLIEREIF GWEAMNVIAC  660
EGAERIERLE TYKQWQVRIS RAGLRQLCK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-4837068525329Protein SCARECROW
5b3h_D2e-4837068525329Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5774841e-114JX577484.1 Gossypium hirsutum clone NBRI_GE9321 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007009233.20.0PREDICTED: scarecrow-like protein 30
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A061FTL40.0A0A061FTL4_THECC; GRAS family transcription factor isoform 2
STRINGEOY180430.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]