PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042655t1
Common NameTCM_042655
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 465aa    MW: 52573.9 Da    PI: 5.8307
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042655t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM146.31.6e-451032331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeek...ewyfFskrdkkyatgkrknratksgyWka 85 
                       lppG+rF+P+deelvv+yL+kk+++k+l+  ++ikev++yk+ P +L +     k +   k   ewyfF++r++ky +g r+nra+ +g+Wka
  Thecc1EG042655t1 103 LPPGYRFKPRDEELVVHYLRKKAHNKPLPP-NIIKEVELYKHSPDELTRdqnnnKST---KpvtEWYFFTPRERKYCNGLRPNRAAGDGFWKA 191
                       79*************************999.89**************8434433333...2455***************************** PP

               NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       tg d++v   +g+ vg kktLvfy+g+ pkgekt+W+mhe+ l
  Thecc1EG042655t1 192 TGADTSVRF-QGTIVGFKKTLVFYRGKPPKGEKTTWIMHEFVL 233
                       ********9.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.15E-51101260IPR003441NAC domain
PROSITE profilePS5100552.077103260IPR003441NAC domain
PfamPF023651.2E-24104233IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MMEQGEEGDQ GYQGFVLPKF TPNGQGDQGF MPPEFTSNGQ GDHGDQGFVL PNFTPNGQGD  60
QGFVLPMFNP NGQGDQGDQG FVLPRYTPNG LVITNEKEFL DTLPPGYRFK PRDEELVVHY  120
LRKKAHNKPL PPNIIKEVEL YKHSPDELTR DQNNNKSTKP VTEWYFFTPR ERKYCNGLRP  180
NRAAGDGFWK ATGADTSVRF QGTIVGFKKT LVFYRGKPPK GEKTTWIMHE FVLSNPPERK  240
RGSKDDMRLD DWVLCRLYKK HGNNTRVVTP QQDPDPDPKQ EEENAIQATD YTETLEQEYW  300
NIPPQYMLPQ QTCPMPPYVV YPDSTSVLPR SMPPYNAYAA DSTSVLLRSM PPYNAYSDST  360
SGLPSSMPPY NAYPDSPSGL PRFPESLDPM LQHQSAVFPQ QAMTVYDNFI PTAAPTLSIP  420
PHFVGHHYPL NSYQQQPFSG VRNNIKFSAD DKYLLNIDFG LPNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-4910226316168NO APICAL MERISTEM PROTEIN
1ut4_B3e-4910226316168NO APICAL MERISTEM PROTEIN
1ut7_A3e-4910226316168NO APICAL MERISTEM PROTEIN
1ut7_B3e-4910226316168NO APICAL MERISTEM PROTEIN
3swm_A5e-4910226319171NAC domain-containing protein 19
3swm_B5e-4910226319171NAC domain-containing protein 19
3swm_C5e-4910226319171NAC domain-containing protein 19
3swm_D5e-4910226319171NAC domain-containing protein 19
3swp_A5e-4910226319171NAC domain-containing protein 19
3swp_B5e-4910226319171NAC domain-containing protein 19
3swp_C5e-4910226319171NAC domain-containing protein 19
3swp_D5e-4910226319171NAC domain-containing protein 19
4dul_A3e-4910226316168NAC domain-containing protein 19
4dul_B3e-4910226316168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021296073.10.0uncharacterized protein LOC110425462
TrEMBLA0A061FMQ50.0A0A061FMQ5_THECC; NAC domain protein, putative
STRINGEOY179720.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-55NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]