PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042466t1
Common NameTCM_042466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 173aa    MW: 19248 Da    PI: 8.114
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042466t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.71.3e-40111101100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+l+r+C+++C++apyf +++pkkfa vhk+FGasnv+k+l ++pee+re++++sl+yeAear+rdPvyG++g i  lq+++ +l+++
  Thecc1EG042466t1  11 SCAACKLLKRRCTPNCIFAPYFRSDEPKKFAKVHKVFGASNVSKILIEVPEEQREETVNSLAYEAEARLRDPVYGCIGAIALLQRKMIELQHD 103
                       6******************************************************************************************** PP

            DUF260  94 lallkee 100
                       lal++e+
  Thecc1EG042466t1 104 LALARER 110
                       **99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.59510111IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-4011108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MRSQEPRSRA SCAACKLLKR RCTPNCIFAP YFRSDEPKKF AKVHKVFGAS NVSKILIEVP  60
EEQREETVNS LAYEAEARLR DPVYGCIGAI ALLQRKMIEL QHDLALARER LARYAATTSS  120
AIISSDRVSM GPFGEFQVPA ASCGGFIDSF SLNSFEVNQD AHMYDFSQIP YV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007008910.11e-126LOB domain-containing protein, putative
SwissprotQ9SRL84e-68LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A061FK881e-126A0A061FK88_THECC; LOB domain-containing protein, putative
STRINGVIT_13s0067g01450.t011e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.13e-61LOB domain-containing protein 21
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]