PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042447t1
Common NameTCM_042447
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 170aa    MW: 18821.5 Da    PI: 7.0823
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042447t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.75.3e-4561051100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +
  Thecc1EG042447t1   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVQQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQ 98 
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++e
  Thecc1EG042447t1  99 LAVAQAE 105
                       ***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0875106IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVQQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQEPMAPTP  120
QLEQDDKSFL LHNNVVLPHH HQYLNFANSS SNVIQDSLKR ESIFGDMVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007008874.11e-123Lateral organ boundaries domain family protein
SwissprotQ8LBW33e-77LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A061FT061e-123A0A061FT06_THECC; Lateral organ boundaries domain family protein
STRINGPOPTR_0008s07280.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.18e-78LBD family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]