PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042392t1
Common NameTCM_042392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 484aa    MW: 54285.6 Da    PI: 6.0732
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042392t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS458.44.4e-140484771373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL++cA++v++g+le+a+  L+++s+laspdgd+mqR+aayfteALa r+++ +++l kal++++ s  ++see+ ++klf+e++P+lk+
  Thecc1EG042392t1  48 LIHLLVQCANHVAAGSLENANIGLEQISHLASPDGDTMQRIAAYFTEALADRMLKAWPGLHKALNSTKIS--SVSEEILVQKLFFELFPFLKL 138
                       689*************************************************************999998..6******************** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       +++++NqaI+ea+ege++vHiiD++ s+++QW++L+q++++Rpegpp+lRiTg+++    +ke le+++ rL++ Ae+l++pf+fn+ ++ +l
  Thecc1EG042392t1 139 AYVITNQAIVEAMEGEKMVHIIDLNSSEPAQWINLFQTFSARPEGPPHLRITGIHE----QKEVLEQMALRLTEEAEKLDIPFQFNP-IVCKL 226
                       ********************************************************....9**************************.5788* PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrll..............................................................des 217
                       e+l+le+Lrvk+gEalaV++vlqlh+ll                                                              +++
  Thecc1EG042392t1 227 ENLDLESLRVKTGEALAVSSVLQLHSLLapddemlrrninspsvsknlnssrphrvlqvnqrtlgewlekepvhiyspsssdlaspspspSSP 319
                       ****************************************************************************************99666 PP

              GRAS 218 vsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrer 308
                       +sl+   +  ++L +++ lsPk++vv+eqe++hn+++++er++eal++y+alfd+le++l+r+  er+kvE++l+g+ei+n++aceg er+er
  Thecc1EG042392t1 320 LSLAPapKLGSFLTALRALSPKLIVVTEQESNHNGPTLMERVMEALNFYAALFDCLESTLSRAPLERQKVEKMLFGEEIKNIIACEGLERKER 412
                       66665557889********************************************************************************** PP

              GRAS 309 hetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       he+lekW  rle aGF+ vpls++ + qa +ll++ + dgy+++ee+g+lv++W++rpL+s+SaW
  Thecc1EG042392t1 413 HEKLEKWILRLELAGFGRVPLSYHGMLQAGRLLQTNNYDGYKIKEENGCLVMCWQERPLYSMSAW 477
                       ***************************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.56122458IPR005202Transcription factor GRAS
PfamPF035141.5E-13748477IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MAGMIQEGPS SVTSPPLPFL PWMSLSPGLG SPFPWLRELK SEERGLYLIH LLVQCANHVA  60
AGSLENANIG LEQISHLASP DGDTMQRIAA YFTEALADRM LKAWPGLHKA LNSTKISSVS  120
EEILVQKLFF ELFPFLKLAY VITNQAIVEA MEGEKMVHII DLNSSEPAQW INLFQTFSAR  180
PEGPPHLRIT GIHEQKEVLE QMALRLTEEA EKLDIPFQFN PIVCKLENLD LESLRVKTGE  240
ALAVSSVLQL HSLLAPDDEM LRRNINSPSV SKNLNSSRPH RVLQVNQRTL GEWLEKEPVH  300
IYSPSSSDLA SPSPSPSSPL SLAPAPKLGS FLTALRALSP KLIVVTEQES NHNGPTLMER  360
VMEALNFYAA LFDCLESTLS RAPLERQKVE KMLFGEEIKN IIACEGLERK ERHEKLEKWI  420
LRLELAGFGR VPLSYHGMLQ AGRLLQTNNY DGYKIKEENG CLVMCWQERP LYSMSAWGFR  480
RYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-42364777378Protein SCARECROW
5b3h_A3e-42364776377Protein SCARECROW
5b3h_D3e-42364776377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017984095.10.0PREDICTED: scarecrow-like protein 3 isoform X1
RefseqXP_017984097.10.0PREDICTED: scarecrow-like protein 3 isoform X1
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A061FKL00.0A0A061FKL0_THECC; Scarecrow-like protein 3 isoform 1
STRINGEOY176060.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40982759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  3. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  4. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]