PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042286t1
Common NameTCM_042286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 396aa    MW: 43000.6 Da    PI: 6.7509
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042286t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-09197245553
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                       kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +
  Thecc1EG042286t1 197 KRAKRILANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLTLFQ 245
                       9****************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-15193257IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.542195258IPR004827Basic-leucine zipper domain
PfamPF001701.7E-8197245IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.95E-10197248No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-9197251No hitNo description
CDDcd147033.96E-23198247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MEIQDPQAKP GPNFNSSSIT RMSGPQPNAT AMFGSSSSSN HNNKSSNNNN PSNSSSSSAF  60
MRGGGGHHRR AHSEMSFRLP DDMSIMMMDL SPPSDPINAG GGSSTASFEE MGSEDDLFST  120
YIDVDKLNSS EATNGRTNCT DHSEGEKLTS SSTTATSSRP RHRHSNSVDG SAYGEVMEAK  180
KAMPPDKLAE LWNLDPKRAK RILANRQSAA RSKERKARYI LELERKVQTL QTEATTLSAQ  240
LTLFQRDTTG LSTENTELKL RLQAMEQQAQ LRDALNEALK KEVERLKIAT GEIMSPSESF  300
SLGMHQMPYT ASTFLSLPPQ QGAAGPQNMQ LPSFTGSQST MSTYHPPQMN QHHLSDIMQN  360
DPLGRLQGLD ISSKGSNLVK TEGPSISASE SSFTF*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017082.10.0PREDICTED: transcription factor RF2b
SwissprotQ6S4P41e-105RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A061GYW10.0A0A061GYW1_THECC; Basic-leucine zipper transcription factor family protein
STRINGEOY347010.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.15e-98bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]