PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042262t1
Common NameTCM_042262
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 223aa    MW: 23926.4 Da    PI: 8.5819
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042262t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.15.6e-42401391100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r da++slvyeA+ r+rdPvyG++g i +lqqq+++l+ae
  Thecc1EG042262t1  40 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKMLMEVPESQRADAANSLVYEANLRLRDPVYGCMGAIVTLQQQMQTLQAE 132
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l+++++e
  Thecc1EG042262t1 133 LNAVRAE 139
                       ***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.71839140IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-4240137IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MSRDRERFDE IGKKIKTDAS SQMGRRHLLG PPGTLNTITP CAACKLLRRR CAEECPFSPY  60
FSPHEPQKFA AVHKVFGASN VSKMLMEVPE SQRADAANSL VYEANLRLRD PVYGCMGAIV  120
TLQQQMQTLQ AELNAVRAEI LKYKFREATS SNIIPSSHAA LISSGAVSIA APLSPLPPIP  180
PPPPPSIVVS SASSSSTSSL YTPPTSAAGY SSISCDNVPY FD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017045.11e-162LOB domain-containing protein 15, putative
SwissprotQ8L5T55e-85LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A061H0E91e-162A0A061H0E9_THECC; LOB domain-containing protein 15, putative
STRINGVIT_13s0067g02380.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-84LOB domain-containing protein 15
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]