PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042240t2
Common NameTCM_042240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 511aa    MW: 55506.9 Da    PI: 8.6328
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042240t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.81.1e-33259316260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Thecc1EG042240t2 259 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 316
                       8****************************************.***************85 PP

2WRKY58.41.4e-183513941659
                       TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY  16 kgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +gs   rsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  Thecc1EG042240t2 351 HGSGQMRSYYKCTHPGCPVRKHVERASHDHRAVITTYEGKHNHD 394
                       789999*************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.5E-29249317IPR003657WRKY domain
SuperFamilySSF1182909.68E-26254317IPR003657WRKY domain
SMARTSM007748.6E-37258316IPR003657WRKY domain
PROSITE profilePS5081128.265259396IPR003657WRKY domain
PfamPF031061.2E-25259315IPR003657WRKY domain
SMARTSM007744.7E-13344395IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.6E-18351396IPR003657WRKY domain
PfamPF031065.2E-13351394IPR003657WRKY domain
SuperFamilySSF1182906.15E-15351396IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MASSCSSLDT SANSHPQNAF SFAAHPFMTT SFSDLLASGG ADDENPSATF DGGVDAKRGG  60
GGGLSLSDRI AERTGSGVPK FKSLPPPSLP IFPPPVSPSS YFAIPAGLSP AELLDSPVLL  120
NASNVLPSPT TGTFPAQAFN WKSNSGNNLQ NVKQEDKNYS NFTFQTQPRP ATSSSSMFQS  180
STNTIQTAQQ QAWSFQESVK QDDFSSGKSM VKPEYTQMQS FSPEIANIQG NSQSNSGFQS  240
EYTKFQQQPQ SIRENRRSDD GYNWRKYGQK QVKGSENPRS YYKCTFPNCP TKKKVERSLD  300
GQITEIVYKG SHNHPKPQST RKSLSSSSSS IVIQTSSAAS AEIPDQSFAT HGSGQMRSYY  360
KCTHPGCPVR KHVERASHDH RAVITTYEGK HNHDVPAARG SGSHSVNRPL PDNNNNNNCN  420
NNAAMAIRPS AVNNHSDHSV TNPLRSLRPP TAEGQAPFTL EMLQGTGNFG FSGFSNSMGS  480
FMNQPQHVNN MFSRTKEEPR DEVFIESLLC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-152593961574WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017983501.10.0PREDICTED: probable WRKY transcription factor 33
TrEMBLA0A061GZ530.0A0A061GZ53_THECC; WRKY DNA-binding protein 33 isoform 2
STRINGEOY346310.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.21e-46WRKY DNA-binding protein 26
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]