PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042240t1
Common NameTCM_042240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 606aa    MW: 65934.1 Da    PI: 7.0603
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042240t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.51.3e-33259316260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Thecc1EG042240t1 259 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 316
                       8****************************************.***************85 PP

2WRKY105.82.3e-33431489159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  Thecc1EG042240t1 431 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDHRAVITTYEGKHNHD 489
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-29249317IPR003657WRKY domain
SuperFamilySSF1182901.24E-25254317IPR003657WRKY domain
SMARTSM007748.6E-37258316IPR003657WRKY domain
PfamPF031061.5E-25259315IPR003657WRKY domain
PROSITE profilePS5081123.824259317IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-37416491IPR003657WRKY domain
SuperFamilySSF1182901.14E-29423491IPR003657WRKY domain
PROSITE profilePS5081138.079426491IPR003657WRKY domain
SMARTSM007741.6E-39431490IPR003657WRKY domain
PfamPF031067.1E-26432489IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MASSCSSLDT SANSHPQNAF SFAAHPFMTT SFSDLLASGG ADDENPSATF DGGVDAKRGG  60
GGGLSLSDRI AERTGSGVPK FKSLPPPSLP IFPPPVSPSS YFAIPAGLSP AELLDSPVLL  120
NASNVLPSPT TGTFPAQAFN WKSNSGNNLQ NVKQEDKNYS NFTFQTQPRP ATSSSSMFQS  180
STNTIQTAQQ QAWSFQESVK QDDFSSGKSM VKPEYTQMQS FSPEIANIQG NSQSNSGFQS  240
EYTKFQQQPQ SIRENRRSDD GYNWRKYGQK QVKGSENPRS YYKCTFPNCP TKKKVERSLD  300
GQITEIVYKG SHNHPKPQST RKSLSSSSSS IVIQTSSAAS AEIPDQSFAT HGSGQMDSVA  360
TPENSSISVG DDDFDQGSQK SKSGGDEFDE DEPEAKRWKS EGENEGISAP GSRTVREPRV  420
VVQTTSDIDI LDDGYRWRKY GQKVVKGNPN PRSYYKCTHP GCPVRKHVER ASHDHRAVIT  480
TYEGKHNHDV PAARGSGSHS VNRPLPDNNN NNNCNNNAAM AIRPSAVNNH SDHSVTNPLR  540
SLRPPTAEGQ APFTLEMLQG TGNFGFSGFS NSMGSFMNQP QHVNNMFSRT KEEPRDEVFI  600
ESLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-37250492878Probable WRKY transcription factor 4
2lex_A3e-37250492878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017983501.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ6B6R41e-138WRK24_ORYSI; WRKY transcription factor WRKY24
TrEMBLA0A061GYP00.0A0A061GYP0_THECC; WRKY DNA-binding protein 33 isoform 1
STRINGEOY346310.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-116WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]