PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042212t1
Common NameTCM_042212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 191aa    MW: 21069.2 Da    PI: 6.2388
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042212t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.92e-44321311100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +
  Thecc1EG042212t1  32 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVGKMLQELPVHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQ 124
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++e
  Thecc1EG042212t1 125 LAVAQTE 131
                       **99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.81431132IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4432129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MISLLDMDIR VIIVYIYNQD ISPEKSMGGS SPCASCKLLR RRCAKDCIFA PYFPSDDPHK  60
FAIVHKVFGA SNVGKMLQEL PVHQRADAVS SLVYEANARV RDPVYGCVGA ISYLQNQVSQ  120
LQMQLAVAQT EILCIQMQQE SALPTQIPQD DKSLLLASTS NLDNISQYLN FASSGNVIQD  180
PALKRESLWT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016975.11e-140Lateral organ boundaries domain family protein
SwissprotQ8LBW34e-79LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A061H0D51e-140A0A061H0D5_THECC; Lateral organ boundaries domain family protein
STRINGPOPTR_0001s28840.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-80LBD family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]