PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042098t1
Common NameTCM_042098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TALE
Protein Properties Length: 842aa    MW: 92569.7 Da    PI: 6.7503
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042098t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-096516881954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Thecc1EG042098t1 651 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 688
                       564459******************************87 PP

2BELL107.11.1e-34512580472
              BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       e q+kkakLl l+eeV++rYk y++q+q+ +ssFe vagl++a+pY+slAlk+++r+FrcL++ai++qi
  Thecc1EG042098t1 512 EYQQKKAKLLYLQEEVCRRYKLYHQQMQMAVSSFESVAGLNAATPYISLALKTVTRNFRCLRNAISDQI 580
                       89******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.0E-48414578IPR006563POX domain
PfamPF075261.7E-41419577IPR006563POX domain
PROSITE profilePS5007112.098629692IPR001356Homeobox domain
CDDcd000861.88E-11632693No hitNo description
SMARTSM003894.1E-8632696IPR001356Homeobox domain
SuperFamilySSF466897.7E-17633698IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-27635696IPR009057Homeodomain-like
PfamPF059204.0E-18649688IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MDMSKFRPES HVAQQSRRDK LRVQQSSNLV QYLEDFPNSL EQGSSVHPEL NPDLVQVRNV  60
RNANLLYDPT LVSSSVIHFS TNSNILTPQR DAMLQQELQT AQQNRQNPAE ESSFSGMSHT  120
ILSKLNASSK VSGDPQGCGN WKSVDSQHSC DWMVGYASGL ADRESNQNPM FVGEVLSNNA  180
RESNMSAATQ YLKPNYSAYQ DVQSTLSNPG SEISSHESKK HYGDLHFVSP SLYQNALQDV  240
VTTSSIATQG LEVASLVQPN VRETARGSWI DYCGNQSSSL HFDNAGAWMN RPLVEHCQQW  300
GGELGFLASK SSEELRTGAS DATTQGLSLS LSSNPTPKIC GAGQFAEEYG SDHGFNSKPG  360
EFRDSQDSKS SKPGYLYSMQ KPSVTSKSSG KSHQDTGGTS TYAYRHTGPL GPFTGYATIL  420
KNSRFLKPAQ ELLDEFCHMT NAKIVKICDA SEGISGELSV SASADAANAV DMEAGASKGN  480
NSGASSSSFY SSNEIRVDVG IGSSSGEPCR PEYQQKKAKL LYLQEEVCRR YKLYHQQMQM  540
AVSSFESVAG LNAATPYISL ALKTVTRNFR CLRNAISDQI RHISRALGEE FLSPTTGTSS  600
SKGDINMSRL KFVGQKSGGV NMGFLEPQQH GWRPQRGLPE RSVAILRAWL FEHFLHPYPT  660
DTDKHMLATQ TGLSRNQVSN WFINARVRVW KPMVEEIHML ESKGLAEGQN SSKNDGKSGE  720
GGPSWLNEDQ SINRSCINVL SDKQLACSDM HVEGITGEEH WNHEKRSRMD FHIPTTMEGS  780
LMGFAPYQPS RLEMGGLGAV SLTLGLRHGV ESAQQHQQQY QRQEDQLRPQ FGGQMIHDFA  840
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A8e-16638695158Homeobox protein Meis1
4xrs_B8e-16638695158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016798.10.0BEL1-like homeodomain 8, putative
TrEMBLA0A061GYR60.0A0A061GYR6_THECC; BEL1-like homeodomain 8, putative
STRINGVIT_06s0004g02580.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143211520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.15e-93BEL1-like homeodomain 8
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]