PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041815t1
Common NameTCM_041815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 830aa    MW: 92905.7 Da    PI: 6.7123
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041815t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.42.1e-1194568261373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL+ cA+a+ss+d   a++lL+++++++sp gd  qRla++f+ AL arla++++++y +l++++ts    ++ l+a++++  ++P++k+
  Thecc1EG041815t1 456 LRTLLILCAQAISSDDSGTAKELLKQIRQHSSPFGDGSQRLAHCFADALDARLAGTGTQIYTSLAAKRTS---AADMLKAYQVYISACPFMKM 545
                       5789************************************************************999999...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       + + aN  Il+ +e+++++HiiDf+i +G+QWpaL++ La+Rp+gpp+lRiTg++ p+ g   +e ++etg+rLa+++e+ +vpfe+n+ +a+
  Thecc1EG041815t1 546 AIFFANINILNVAEKATTLHIIDFGIFYGFQWPALIHRLADRPGGPPKLRITGIEFPRRGfrPAEGVQETGHRLARYCERYHVPFEYNA-IAQ 637
                       **********************************************************9999***************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e++++e+L+++++E++aVn+ ++  +llde+v l+s+rd+vL+l+++++P+++v++  + ++n++ F++rf eal ++salfd+ e+++pr
  Thecc1EG041815t1 638 KWETIRTEDLKINSNEVIAVNCLIRFRNLLDETVVLNSPRDTVLNLIRKINPDIFVHSIVNGSYNAPFFVTRFREALFHFSALFDMCETNVPR 730
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       e+  r ++E+++ grei+n+vaceg+er+er e++++W+ r ++aGF+++pl+ +++k ++  l+ ++   ++v+ +  ++++gWk+r +++ 
  Thecc1EG041815t1 731 EDPMRLMLEQKFYGREIMNIVACEGTERVERPESYKQWQVRNMRAGFRQLPLDPEIMKRVRDKLKACYHSDFMVDVDGRWMLQGWKGRIIYAS 823
                       ********************************************************************777********************** PP

              GRAS 371 SaW 373
                       SaW
  Thecc1EG041815t1 824 SAW 826
                       *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.682430807IPR005202Transcription factor GRAS
PfamPF035147.1E-117456826IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MEDFDPDHQV PPCKTMSHDV DFGGEGNRKI GRSDTHDAPP SDNTKLRTDQ SQSGKRRARK  60
TKFVAGALNG FPNSVNGFKF DNGFILPNSN GYPKFEISNG VKPIDVDFSS LGAPFLPSLG  120
LDNSSTSTSL LTMEKEGDSS SPSDDSDFSD TVLKYISQVL LEEDMDEKPC MFHDSLALQA  180
AEKSLYEVLG ESYPRPNQAP LCKDLSVESP DNCSLGTYSD HSTFSGSSSC TSNSIDSRWN  240
GDFREKNNKP SLLQMSIPEN FVFQSTVNSG SQPSGRFQNG NVKNGNGLVG SSVSELAIPN  300
CFGESELALH FKRGVEEASK FLPKGNQLTI DFDSNAWTSE LKQKAPKTVV KVERDEEYSP  360
PMLTGKKNHE REDEDLEEGR NNKQSAVFWD ECELSDMFDK VLICAGRRGQ SSTCDADKTL  420
QNAPRKMLQQ NDQSNGSGSG KARSKKQGKK KEVVDLRTLL ILCAQAISSD DSGTAKELLK  480
QIRQHSSPFG DGSQRLAHCF ADALDARLAG TGTQIYTSLA AKRTSAADML KAYQVYISAC  540
PFMKMAIFFA NINILNVAEK ATTLHIIDFG IFYGFQWPAL IHRLADRPGG PPKLRITGIE  600
FPRRGFRPAE GVQETGHRLA RYCERYHVPF EYNAIAQKWE TIRTEDLKIN SNEVIAVNCL  660
IRFRNLLDET VVLNSPRDTV LNLIRKINPD IFVHSIVNGS YNAPFFVTRF REALFHFSAL  720
FDMCETNVPR EDPMRLMLEQ KFYGREIMNI VACEGTERVE RPESYKQWQV RNMRAGFRQL  780
PLDPEIMKRV RDKLKACYHS DFMVDVDGRW MLQGWKGRII YASSAWILA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-534388261378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021278290.10.0LOW QUALITY PROTEIN: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A061GX450.0A0A061GX45_THECC; SCARECROW-like 14, putative
STRINGEOY340030.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]