PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041810t1
Common NameTCM_041810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 706aa    MW: 79445.4 Da    PI: 6.731
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041810t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS389.24.5e-1193327013374
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cA+av+ +d++ a++lL+++s+++s +gd +qRla+yf++AL++rla+++   y  l +++ts    +++l+a+ +++ ++P+ k+s+
  Thecc1EG041810t1 332 SLLTQCAQAVTINDQRTANELLKQISQHSSASGDGTQRLAHYFANALKTRLAGNGAPSYLPLLSNRTS---AADVLKAYGVYVLACPFKKMSN 421
                       79***************************************************777777555555554...99******************** PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                       + aN+ I+e +e+++++Hi+Df+i +G+QWp+L+q L++R++gpp+lRiTg++ p++g   +e++eetg+rL++++e+++vpfe+nv +ak++
  Thecc1EG041810t1 422 FYANKKIMEVAEKATTLHIVDFGICYGFQWPCLIQRLSARANGPPKLRITGIEFPQPGfrPAERVEETGRRLKRYCERFQVPFEYNV-IAKKW 513
                       *********************************************************9****************************9.7**** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       e+++leeL+++++E+++Vn++++l++l+d++v+ +s+rd+vLkl++s++P+++++   +  +n++ F++rf eal ++sa fd +ea+++re+
  Thecc1EG041810t1 514 ETIQLEELKIDKDEVVVVNCMYRLKNLPDDTVAPTSARDTVLKLIRSINPQLFIHGAANGTYNAPFFVTRFREALFHFSAQFDIFEANVSRED 606
                       ********************************************************************************************* PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                        +r++ E+e++gr+i+nv+aceg+er+er et+++W++r ++aGFk+vpl+++  k++  ++r  + + + v+ +  ++++gWk+r ++++++
  Thecc1EG041810t1 607 PQRMMFEKEVIGRDIMNVIACEGTERVERPETYKQWQSRTKRAGFKQVPLDQELLKKVTNMVRSSYHRDFVVDVDGRWMLQGWKGRVIYALTC 699
                       ******************************************************************999************************ PP

              GRAS 373 Wr 374
                       W+
  Thecc1EG041810t1 700 WK 701
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.047304681IPR005202Transcription factor GRAS
PfamPF035141.6E-116332701IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MDTLFQDFPS SMYGFKFDHG SAPVYSNHNL VNGFKESPER MVPNPPSLPT SPDSPVDSAS  60
SSGVSSDGHP LDNIPFANEM LKYINEMLME EDIDEKTCML QDCLALQAAE KSFYEALGHE  120
YPLSADPLSL CTGQNGYYLD DNLTERSSTG SSNRYTTATS LVESSGKYSP GEVKSSYIQT  180
SLIDSLERTS LVPDLQRETT LESLRHFRTG IGEASKSSLN GDKVLLAPES NLSRPSVSDG  240
RYQSPSGSRG RKNYQREDDD YLEEGRSNKQ SAISLEDSEQ SDMFDDVLLC KGENDYSPRC  300
SFNGNSQLKG SNGGTTRKKK NDKKSEVVDL WSLLTQCAQA VTINDQRTAN ELLKQISQHS  360
SASGDGTQRL AHYFANALKT RLAGNGAPSY LPLLSNRTSA ADVLKAYGVY VLACPFKKMS  420
NFYANKKIME VAEKATTLHI VDFGICYGFQ WPCLIQRLSA RANGPPKLRI TGIEFPQPGF  480
RPAERVEETG RRLKRYCERF QVPFEYNVIA KKWETIQLEE LKIDKDEVVV VNCMYRLKNL  540
PDDTVAPTSA RDTVLKLIRS INPQLFIHGA ANGTYNAPFF VTRFREALFH FSAQFDIFEA  600
NVSREDPQRM MFEKEVIGRD IMNVIACEGT ERVERPETYK QWQSRTKRAG FKQVPLDQEL  660
LKKVTNMVRS SYHRDFVVDV DGRWMLQGWK GRVIYALTCW KPVRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-483347018375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017983408.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_017983409.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A061GVV60.0A0A061GVV6_THECC; GRAS family transcription factor, putative
STRINGEOY339950.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]