PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041332t3
Common NameTCM_041332
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 477aa    MW: 54280.4 Da    PI: 9.3988
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041332t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.46e-49912141128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       + pGfrF+Ptd el+++yLkkk++g +  + evi+e++i+++ePwdLp    ++++ew+fF+ r +ky++g++++rat++gyWkatgk+++v+
  Thecc1EG041332t3  91 MFPGFRFSPTDVELISYYLKKKLDGYDKCV-EVISEIEICRHEPWDLP-V-IKSDNEWFFFCARGRKYPNGSQSRRATEQGYWKATGKERNVK 180
                       579***********************9777.99***************.3.45689************************************* PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Thecc1EG041332t3 181 S-GSNVIGTKRTLVFHMGRAPKGERTEWIMHEYCM 214
                       *.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-5382229IPR003441NAC domain
PROSITE profilePS5100551.06891230IPR003441NAC domain
PfamPF023656.1E-2593213IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
NLTYPLFLIR FLEAESYQTK SKSKRNPKGK KILLLLNRTN NRLLYFFSPI LNIRTNRKTK  60
RRRSLSWFFA LVMAGEGVSR ETQMSIEASS MFPGFRFSPT DVELISYYLK KKLDGYDKCV  120
EVISEIEICR HEPWDLPVIK SDNEWFFFCA RGRKYPNGSQ SRRATEQGYW KATGKERNVK  180
SGSNVIGTKR TLVFHMGRAP KGERTEWIMH EYCMNGKSQD SLVVCRLRKN SEFRLNNTTN  240
QASRNQQELS TMHDSRATSD GGTDQTGMSE GDKAVEFYSK KVTSSYDSHS IEQIDSASES  300
EEKHSNDVAP TESSTPQKDS DGEEDYFAEI LKDDIIKLDE TSLSAMPPDS LSMVASTSDT  360
ERRTQQPRQE NVPNASPFQG TASRRIKLWR PKGDILCDAA SGSLVRELAV EKQSSPKIEE  420
SPKCLLSIFS PRTANLRLIY ASFVILTLLA LFLSLIGDSK PVKDFKYAAF YKNFWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-409022916164NO APICAL MERISTEM PROTEIN
1ut4_B5e-409022916164NO APICAL MERISTEM PROTEIN
1ut7_A5e-409022916164NO APICAL MERISTEM PROTEIN
1ut7_B5e-409022916164NO APICAL MERISTEM PROTEIN
3swm_A6e-409022919167NAC domain-containing protein 19
3swm_B6e-409022919167NAC domain-containing protein 19
3swm_C6e-409022919167NAC domain-containing protein 19
3swm_D6e-409022919167NAC domain-containing protein 19
3swp_A6e-409022919167NAC domain-containing protein 19
3swp_B6e-409022919167NAC domain-containing protein 19
3swp_C6e-409022919167NAC domain-containing protein 19
3swp_D6e-409022919167NAC domain-containing protein 19
4dul_A5e-409022916164NAC domain-containing protein 19
4dul_B5e-409022916164NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15562NRKTKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015733.20.0PREDICTED: NAC domain-containing protein 89
TrEMBLA0A061GZN70.0A0A061GZN7_THECC; NAC domain-containing protein 74, putative isoform 3 (Fragment)
STRINGEOY333540.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104532533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.16e-88NTM1-like 8
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]