PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041332t2
Common NameTCM_041332
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 386aa    MW: 43260.5 Da    PI: 6.0322
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041332t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.31.5e-49191451128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                       + pGfrF+Ptd el+++yLkkk++g +  + evi+e++i+++ePwdLp k+v ++++ew+fF+ r +ky++g++++rat++gyWkatgk+++v
  Thecc1EG041332t2  19 MFPGFRFSPTDVELISYYLKKKLDGYDKCV-EVISEIEICRHEPWDLPaKSVIKSDNEWFFFCARGRKYPNGSQSRRATEQGYWKATGKERNV 110
                       579***********************9777.99***************667777899************************************ PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Thecc1EG041332t2 111 KS-GSNVIGTKRTLVFHMGRAPKGERTEWIMHEYCM 145
                       **.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-5310151IPR003441NAC domain
PROSITE profilePS5100548.7119164IPR003441NAC domain
PfamPF023654.7E-2521144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MAGEGVSRET QMSIEASSMF PGFRFSPTDV ELISYYLKKK LDGYDKCVEV ISEIEICRHE  60
PWDLPAKSVI KSDNEWFFFC ARGRKYPNGS QSRRATEQGY WKATGKERNV KSGSNVIGTK  120
RTLVFHMGRA PKGERTEWIM HEYCMNGKSQ ASRNQQELST MHDSRATSDG GTDQTGMSEG  180
DKAVEFYSKK VTSSYDSHSI EQIDSASESE EKHSNDVAPT ESSTPQKDSD GEEDYFAEIL  240
KDDIIKLDET SLSAMPPDSL SMVASTSDTE RRTQQPRQEN VPNASPFQGT ASRRIKLWRP  300
KGDILCDAAS GSLVRELAVE KQSSPKIEES PKCLLSIFSP RTANLRLIYA SFVILTLLAL  360
FLSLIGDSKP VKDFKYAAFY KNFWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-391814316140NO APICAL MERISTEM PROTEIN
1ut4_B1e-391814316140NO APICAL MERISTEM PROTEIN
1ut7_A1e-391814316140NO APICAL MERISTEM PROTEIN
1ut7_B1e-391814316140NO APICAL MERISTEM PROTEIN
3swm_A1e-391814319143NAC domain-containing protein 19
3swm_B1e-391814319143NAC domain-containing protein 19
3swm_C1e-391814319143NAC domain-containing protein 19
3swm_D1e-391814319143NAC domain-containing protein 19
3swp_A1e-391814319143NAC domain-containing protein 19
3swp_B1e-391814319143NAC domain-containing protein 19
3swp_C1e-391814319143NAC domain-containing protein 19
3swp_D1e-391814319143NAC domain-containing protein 19
4dul_A1e-391814316140NAC domain-containing protein 19
4dul_B1e-391814316140NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472391e-161KC847239.1 Gossypium hirsutum NAC domain protein NAC62 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015733.20.0PREDICTED: NAC domain-containing protein 89
TrEMBLA0A061GVB50.0A0A061GVB5_THECC; NAC domain-containing protein 74, putative isoform 2
STRINGEOY333540.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.13e-82NAC domain containing protein 89
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]