PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041332t1
Common NameTCM_041332
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 408aa    MW: 45850.4 Da    PI: 6.5276
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041332t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.21.7e-49191451128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                       + pGfrF+Ptd el+++yLkkk++g +  + evi+e++i+++ePwdLp k+v ++++ew+fF+ r +ky++g++++rat++gyWkatgk+++v
  Thecc1EG041332t1  19 MFPGFRFSPTDVELISYYLKKKLDGYDKCV-EVISEIEICRHEPWDLPaKSVIKSDNEWFFFCARGRKYPNGSQSRRATEQGYWKATGKERNV 110
                       579***********************9777.99***************667777899************************************ PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Thecc1EG041332t1 111 KS-GSNVIGTKRTLVFHMGRAPKGERTEWIMHEYCM 145
                       **.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-5510160IPR003441NAC domain
PROSITE profilePS5100552.16719161IPR003441NAC domain
PfamPF023655.2E-2521144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MAGEGVSRET QMSIEASSMF PGFRFSPTDV ELISYYLKKK LDGYDKCVEV ISEIEICRHE  60
PWDLPAKSVI KSDNEWFFFC ARGRKYPNGS QSRRATEQGY WKATGKERNV KSGSNVIGTK  120
RTLVFHMGRA PKGERTEWIM HEYCMNGKSQ DSLVVCRLRK NSEFRLNNTT NQASRNQQEL  180
STMHDSRATS DGGTDQTGMS EGDKAVEFYS KKVTSSYDSH SIEQIDSASE SEEKHSNDVA  240
PTESSTPQKD SDGEEDYFAE ILKDDIIKLD ETSLSAMPPD SLSMVASTSD TERRTQQPRQ  300
ENVPNASPFQ GTASRRIKLW RPKGDILCDA ASGSLVRELA VEKQSSPKIE ESPKCLLSIF  360
SPRTANLRLI YASFVILTLL ALFLSLIGDS KPVKDFKYAA FYKNFWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-421816016164NO APICAL MERISTEM PROTEIN
1ut4_B7e-421816016164NO APICAL MERISTEM PROTEIN
1ut7_A7e-421816016164NO APICAL MERISTEM PROTEIN
1ut7_B7e-421816016164NO APICAL MERISTEM PROTEIN
3swm_A8e-421816019167NAC domain-containing protein 19
3swm_B8e-421816019167NAC domain-containing protein 19
3swm_C8e-421816019167NAC domain-containing protein 19
3swm_D8e-421816019167NAC domain-containing protein 19
3swp_A8e-421816019167NAC domain-containing protein 19
3swp_B8e-421816019167NAC domain-containing protein 19
3swp_C8e-421816019167NAC domain-containing protein 19
3swp_D8e-421816019167NAC domain-containing protein 19
4dul_A7e-421816016164NAC domain-containing protein 19
4dul_B7e-421816016164NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015733.20.0PREDICTED: NAC domain-containing protein 89
TrEMBLA0A061GVZ70.0A0A061GVZ7_THECC; NAC domain protein, IPR003441, putative isoform 1
STRINGEOY333540.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.12e-91NTM1-like 8
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]