PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041094t1
Common NameTCM_041094
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 218aa    MW: 23467.6 Da    PI: 5.2087
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041094t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.78.2e-43551541100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+
  Thecc1EG041094t1  55 PCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQ 147
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++e
  Thecc1EG041094t1 148 LAKAQAE 154
                       **99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.13454155IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-4355152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MFKMEYTEAT PPPPPTTTTT TSSPQSLSPN SSNSSSSPPP PPPTTTSTPP VVISPCAACK  60
ILRRRCADKC VLAPYFPPTE PAKFTIAHRV FGASNIIKFL QELPESQRAD AVSSMVYEAS  120
ARIRDPVYGC AGAICQLQKQ VNELQAQLAK AQAEVVNMQL QQANLVALLC VEMAQSPQPN  180
SQQSVDTFIS SPPSYQSNPG FLEDNNNLGS LWEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015486.11e-157LOB domain-containing protein 1
SwissprotQ9SK082e-80LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A061GTD11e-157A0A061GTD1_THECC; LOB domain-containing protein 1
STRINGGLYMA11G15810.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.17e-73LOB domain-containing protein 11
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]