PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041051t1
Common NameTCM_041051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NF-YC
Protein Properties Length: 225aa    MW: 25614.8 Da    PI: 10.0188
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041051t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC414.1e-13116206999
             NF-YC   9 qiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                       + e++++ k  ++P+ rik+i+k+++    i  ++  l+ ka e f+ ++    +  + + ++++l    ++++v +   +dfl d vp++
  Thecc1EG041051t1 116 EEEEEEEAKMCRFPMNRIKRIMKSEDSRVAIPQDVVFLVNKATEKFLEQFCEDGYKSSVKDRKKSLSYKHLSTVVHERRRYDFLSDYVPEK 206
                       5688889999******************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.2E-14127190IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.3E-20128205IPR009072Histone-fold
SuperFamilySSF471131.64E-15137206IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MASSKKPTEE ENKKKKKKSN SSPAKETKTA LKKPDKKAST TEKANKSKPK PKPKPKPDSN  60
KNKSSNGTLV ESEVIAVPSS STDTKEQEDE NKTNKNVKSN KRKQKEKVEE NEGEEEEEEE  120
EEAKMCRFPM NRIKRIMKSE DSRVAIPQDV VFLVNKATEK FLEQFCEDGY KSSVKDRKKS  180
LSYKHLSTVV HERRRYDFLS DYVPEKIKAE DALKERNLTE TGAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015427.11e-158Nuclear factor Y, putative
TrEMBLA0A061GU641e-158A0A061GU64_THECC; Nuclear factor Y, putative
STRINGPOPTR_0009s01750.15e-48(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-37nuclear factor Y, subunit C10
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]