PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG040737t1
Common NameTCM_040737
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 403aa    MW: 46073.4 Da    PI: 5.5259
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG040737t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.35.6e-48601852128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       ppG+rF P deelv +yLkkkv++++l+  + i ev++y+++P++L +k+k+ +ekewyfF++rdkky++g+r+nra+ +gyWkatg d++v+
  Thecc1EG040737t1  60 PPGYRFCPLDEELVLHYLKKKVKNERLPH-NRIVEVNLYHHNPETLAEKYKQyGEKEWYFFTPRDKKYRNGTRPNRAAGDGYWKATGADRQVI 151
                       9*************************999.77**************9544443889************************************* PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         kg++vg +k Lvfykg+ pkg kt+W+mheyr+
  Thecc1EG040737t1 152 Y-KGHTVGFRKALVFYKGKPPKGDKTNWIMHEYRV 185
                       *.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-5558211IPR003441NAC domain
PROSITE profilePS5100554.66959211IPR003441NAC domain
PfamPF023651.8E-2560185IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
METDEKPKPT LQSLVRKQLR PLNESSSDAS TVEVLKKEDS IKDSEENGDG GGDEYLDSFP  60
PGYRFCPLDE ELVLHYLKKK VKNERLPHNR IVEVNLYHHN PETLAEKYKQ YGEKEWYFFT  120
PRDKKYRNGT RPNRAAGDGY WKATGADRQV IYKGHTVGFR KALVFYKGKP PKGDKTNWIM  180
HEYRVNDPPP CKRVYNDMRL DDWVLCRIYK KVDKSISRTR SKEENQSPLI DNEDTNELMN  240
MDFDYNGGVD SMDYSSFLHQ SLSDGSYNNL QPVSDQFPTL TLSYGAHSKI VDSQSLRSLS  300
MKYPIDKGGQ DDIWSVVNLD FASQLELYGV SCVEPLINLD NNFSVDASNY SSANSKTDGT  360
GVGEASLKAS GEFERIWYYI LLFQVTQNSA EKSMIALDNW VL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-555821119168NAC domain-containing protein 19
3swm_B1e-555821119168NAC domain-containing protein 19
3swm_C1e-555821119168NAC domain-containing protein 19
3swm_D1e-555821119168NAC domain-containing protein 19
3swp_A1e-555821119168NAC domain-containing protein 19
3swp_B1e-555821119168NAC domain-containing protein 19
3swp_C1e-555821119168NAC domain-containing protein 19
3swp_D1e-555821119168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017982374.10.0PREDICTED: NAC domain-containing protein 67
SwissprotA2YMR02e-62NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A061GZA80.0A0A061GZA8_THECC; NAC domain transcriptional regulator superfamily protein, putative
STRINGEOY327090.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1887468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.16e-62NAC domain containing protein 32
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]