PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG038269t1
Common NameTCM_038269
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TALE
Protein Properties Length: 354aa    MW: 39501.7 Da    PI: 6.6469
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG038269t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.71.7e-072502822254
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        +yp++e++++L +++gL+ +q+ +WF N+R +
  Thecc1EG038269t1 250 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 282
                       59*****************************87 PP

2ELK30.57.9e-11203224122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELKh+L+++Y+++++++++E++
  Thecc1EG038269t1 203 ELKHELKQGYKEKIVDVREEIL 224
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.8E-184084IPR005540KNOX1
PfamPF037907.2E-174382IPR005540KNOX1
SMARTSM012564.9E-2391146IPR005541KNOX2
PfamPF037919.8E-1696145IPR005541KNOX2
PfamPF037894.6E-7203224IPR005539ELK domain
SMARTSM011888.9E-4203224IPR005539ELK domain
PROSITE profilePS512139.83203223IPR005539ELK domain
PROSITE profilePS5007111.823223286IPR001356Homeobox domain
SMARTSM003894.2E-10225290IPR001356Homeobox domain
SuperFamilySSF466891.41E-15225289IPR009057Homeodomain-like
CDDcd000862.31E-11226287No hitNo description
Gene3DG3DSA:1.10.10.605.9E-25230287IPR009057Homeodomain-like
PfamPF059209.3E-18243282IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MAFDGFVSDH TKNMQTLALN GTAASASASA AADVDHWERA KHKAEIMGHP MYDQLLEAHV  60
ACLRVATPVD QLAKIDAQLA RSQQVLAKYS ATAATASDDE LDHFMTNYVL LLGFFKDQLQ  120
QHVRVHAMEA VMACWDLEQS LQSLTGVSPG EGTGATMSDD EDEVVDSDTS LFDGSLDGID  180
SMGFGPLIPS ETERSLMERV RQELKHELKQ GYKEKIVDVR EEILRKRRAG KLPGDTTSLL  240
KAWWQSHSKW PYPTEEDKAR LVQETGLQLK QINNWFINQR KRNWQSNPST SLKSKRKSFR  300
ACIIGDCNGK SGYKTTSVGC FILLTWLAII NNKFCGSALQ MGWHEHQSVL VNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-13226290872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007013698.10.0Homeobox protein knotted-1-like 3
SwissprotP480001e-160KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A061GQ900.0A0A061GQ90_THECC; Homeobox protein knotted-1-like 3
STRINGVIT_04s0008g06130.t011e-159(Vitis vinifera)
STRINGPGSC0003DMT4000403511e-160(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-152KNOTTED1-like homeobox gene 4
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]