PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG037852t1
Common NameTCM_037852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family CPP
Protein Properties Length: 612aa    MW: 65183.2 Da    PI: 7.8158
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG037852t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.43.2e-14125164242
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                       ++k+CnCk+s+Clk+YCeCfa+g +C+  C+C +C N+ e+
  Thecc1EG037852t1 125 KQKQCNCKHSRCLKLYCECFASGIYCDG-CNCVNCYNNVEN 164
                       89**************************.********9875 PP

2TCR50.83.2e-16209248140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Thecc1EG037852t1 209 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 248
                       589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.5E-16124164IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.811125249IPR005172CRC domain
PfamPF036384.3E-11126161IPR005172CRC domain
SMARTSM011148.4E-20209250IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12212247IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MGEGEGEGGD FPPKKVQSDT ADFPAKKLAR QLDFTAGFGG VSSGGVVLPE HPQSTQGIAT  60
AAAAAVTQQH QQQQQQQIKP PVIATTPVAA TQPPPLTTAS SRVVKPESPK AKPRPNELKD  120
GTPKKQKQCN CKHSRCLKLY CECFASGIYC DGCNCVNCYN NVENEAARRD AVEATLERNP  180
NAFRPKIASS PHGARDCREE AGEGLMLGKH NKGCHCKKSG CLKKYCECFQ ANILCSENCK  240
CMDCKNFEGS EERQALFHGD HANNMAYIQQ AANAAITGAI GSSGYASLPV SKKRKGQELF  300
FGSTAKDPSV HRLGQFPQAN HIRASAPSSS LSSMPVSRAG ATAAVGPSKF TYRSLLADII  360
QKQDLRELCS VLVVLSGEAA KTLADQRSLT EKRAEDQTET SLASSTQDRL QSQKDSDAEK  420
TTADDCSSAN QADKAGPEDS SSDGADMPKG RPMSPGTLAL MCDEQDTMFM AAASPNGIMG  480
HGCSTSSQLP YGQGMTEIYA EQERIVLTKF RDCLNRLITF GDIKETQCSS LARTEIVSQR  540
GPLSNGTEIV RTEAGNRQGS ITNGVAKTVS PLTVKTSQMA AAVVTTANND LPRVPSLPEN  600
GDAKTKAEKQ M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-311172582132Protein lin-54 homolog
5fd3_B2e-311172582132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007013127.20.0PREDICTED: LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A061GMK60.0A0A061GMK6_THECC; Tesmin/TSO1-like CXC domain-containing protein
STRINGEOY307460.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]