PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG037343t1
Common NameTCM_037343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 160aa    MW: 18248.8 Da    PI: 4.807
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG037343t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.41.1e-3198156159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYG+K+vk+s++pr+YYrC+ +gC+vkk+ver++edp++v++tYeg Hnh+
  Thecc1EG037343t1  98 LDDGYRWRKYGKKMVKNSPNPRNYYRCSVEGCTVKKRVERDREDPSYVVTTYEGIHNHQ 156
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-3384157IPR003657WRKY domain
SuperFamilySSF1182909.02E-2990157IPR003657WRKY domain
PROSITE profilePS5081130.74593158IPR003657WRKY domain
SMARTSM007741.1E-3698157IPR003657WRKY domain
PfamPF031061.3E-2499156IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MSTVNFKPPD SPESDHANQS NFEFPDDYFT FDSWLEDCPE AISSGTTENP VNQANEVNDS  60
AGASSLLQGP AGESETIRER REFKERYAFR TKSEVEILDD GYRWRKYGKK MVKNSPNPRN  120
YYRCSVEGCT VKKRVERDRE DPSYVVTTYE GIHNHQSAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-2788155774Probable WRKY transcription factor 4
2lex_A4e-2788155774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012369.11e-117PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ56e-42WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A061GKP71e-115A0A061GKP7_THECC; WRKY DNA-binding protein 50, putative
STRINGEOY299881e-116(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-44WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]