PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG037293t1
Common NameTCM_037293
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 243aa    MW: 26598.4 Da    PI: 7.9103
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG037293t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.72.2e-39151141100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCaaCk++rrkC+++C lap fpa+++k+f n+hklFG+sn+lk++++l++ +r +am+s+v+eA+ ra+dPv G++g+i++l+ q++ +kae
  Thecc1EG037293t1  15 ACAACKYQRRKCTRNCLLAPFFPANHQKDFLNAHKLFGVSNILKIIRNLDPPQRLIAMKSIVFEANTRANDPVGGCYGIISDLKMQIDWVKAE 107
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                        +l+ ++
  Thecc1EG037293t1 108 RDLVLHQ 114
                       9988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.96314115IPR004883Lateral organ boundaries, LOB
PfamPF031959.0E-3715110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MQRPKGNNCS AGSPACAACK YQRRKCTRNC LLAPFFPANH QKDFLNAHKL FGVSNILKII  60
RNLDPPQRLI AMKSIVFEAN TRANDPVGGC YGIISDLKMQ IDWVKAERDL VLHQLAICKA  120
QTAAASQQQS GQQQMVQVGD HEANALQCLE GLTVYDAMPV HCREGEVNLV QGNYDDVGED  180
IKPLLPVFDD KGAGSFPFDS KVSIQCSDKL VSKEEVGSIQ HELKHDLKSA ASLFTLTNGK  240
SR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012290.10.0LOB domain-containing 22-like protein
SwissprotQ9LRW14e-43LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A061GRZ60.0A0A061GRZ6_THECC; LOB domain-containing 22-like protein
STRINGPGSC0003DMT4000124984e-49(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2211645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-43LOB domain-containing protein 22
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]