PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG037162t2
Common NameTCM_037162
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family CPP
Protein Properties Length: 527aa    MW: 57616.4 Da    PI: 7.9722
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG037162t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14156195242
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                       ++k+CnCk+s+Clk+YCeCfaag +C+  C+C +C+N+ e+
  Thecc1EG037162t2 156 KQKQCNCKNSRCLKLYCECFAAGIYCNG-CNCINCHNNVEN 195
                       89**************************.********9875 PP

2TCR49.77.5e-16240279140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       k++kgC+Ckks ClkkYCeC++a+  Cse+CkC dCkN e
  Thecc1EG037162t2 240 KHNKGCHCKKSGCLKKYCECYQANILCSENCKCMDCKNFE 279
                       589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.9E-17155195IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.804156280IPR005172CRC domain
PfamPF036387.0E-12157192IPR005172CRC domain
SMARTSM011141.5E-19240281IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.6E-12243278IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MEQGETVSDF APKKLARQLD FTTMCRASAN ATLPDHPMHL QSQSQPQPQW PSQTPLQTKH  60
QQQPQPQELQ LRLYFQPQTV QSPPQPQLKP QSPPMPQVQT RPPPPPPPQQ QQVAVVHRVP  120
HPVQKLSLPT FQLSKQESPR SGPRGHVDGK DGTPKKQKQC NCKNSRCLKL YCECFAAGIY  180
CNGCNCINCH NNVENEAARQ EAVGATLERN PNAFRPKIAS SPHRPQDARD DARDVQMVGK  240
HNKGCHCKKS GCLKKYCECY QANILCSENC KCMDCKNFEG SEERRALFHG DHNSMAYMQQ  300
AANAAISGAI GSSGYGTPLA SKKRKSEEFL FGVAVNDQFN QKIVQHQQEN HLKNPVATSF  360
PFSAPVSRAA NTASLGSSKL TYRSPLADIL QPQDVKELCS VLVLVSSEAE RALAAEKSSK  420
MDSQTEKGSI ETIVSSGQAG EMCQQGNGVH RGATNDRTSE NQADADRSGN SGADGDDVQN  480
GRPLSPGTRA LMCDEEDAMF MAAGSSNVLA DHSQNMTQKS SNGHECT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-331512895132Protein lin-54 homolog
5fd3_B2e-331512895132Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6225216e-55JX622521.1 Gossypium hirsutum clone NBRI_GE69283 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012085.20.0PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_017983870.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLA0A061GJZ20.0A0A061GJZ2_THECC; Transcription factor, putative isoform 1
STRINGEOY297030.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-119Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]