PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG037060t1
Common NameTCM_037060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 508aa    MW: 55453.2 Da    PI: 5.1811
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG037060t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.73.1e-25196252259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+ei+++g H he
  Thecc1EG037060t1 196 SDGYNWRKYGQKQVKSPKGSRSYYKCTFSDCRAKK-IECSDHTGHVIEIVNKGMHSHE 252
                       8********************************98.*********************8 PP

2WRKY98.63.9e-31370426359
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  Thecc1EG037060t1 370 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTNAVIITYKGVHDHD 426
                       9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.7E-20191254IPR003657WRKY domain
SuperFamilySSF1182902.09E-19193254IPR003657WRKY domain
SMARTSM007742.1E-23195253IPR003657WRKY domain
PROSITE profilePS5081116.65196254IPR003657WRKY domain
PfamPF031061.5E-16197251IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-31353428IPR003657WRKY domain
PROSITE profilePS5081132.041363428IPR003657WRKY domain
SuperFamilySSF1182906.8E-27364428IPR003657WRKY domain
SMARTSM007743.5E-35368427IPR003657WRKY domain
PfamPF031062.9E-23370425IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MAETESQAQQ TKRQEDQQKD DLEGEEEEEE EEEEEEEDGE LEEEEEEEEG MSRASESQGA  60
GAAPSSDAEL RDSQTLTNDD RWEGLQVNSS SESKERAEFK EQVKVAQQEV LPSLVVQGAE  120
AQTQNQPRLS VSPTSLPQSS PTSVAQGVLS APTPTLPEEC LSDQKVNGAS VPEANRQTSS  180
NLKTVSVVPI VKTPVSDGYN WRKYGQKQVK SPKGSRSYYK CTFSDCRAKK IECSDHTGHV  240
IEIVNKGMHS HEPPRKHNLT RESKVVSSAV PISRNIVTEQ PIRIPNDSDL STSSKDSVQE  300
TTVNPERKRQ CSSGSDGNGD VQVKEEHLSE PEPKRRMKKG NAVCSGSVLK SGKKPKFVVH  360
AAGDVGISGD GYRWRKYGQK MVKGNPNPRN YYRCTSAGCP VRKHIETAVD NTNAVIITYK  420
GVHDHDMPVP KKRHGPPSAP LVAAAAPASM NNLQFKKTDG VQNQVTSTQW SVGTEGELTG  480
EALDLGGEKA MESARTLLSI GFEIKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A5e-26356428274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011940.10.0WRKY DNA-binding protein 32, putative
SwissprotP595831e-146WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A061GR000.0A0A061GR00_THECC; WRKY DNA-binding protein 32, putative
STRINGVIT_11s0037g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-136WRKY DNA-binding protein 32
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]