PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG036034t1
Common NameTCM_036034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 419aa    MW: 47645.8 Da    PI: 8.9338
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG036034t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.4e-53611901129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeel+++yLkkkv+ +k+++ evi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk
  Thecc1EG036034t1  61 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-EVIREVDLNKMEPWDLQErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATSAGFWKATGRDK 152
                       69****************************.99**************963433332556********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                        + + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  Thecc1EG036034t1 153 CIRN-TYRKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 190
                       ***9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-5959219IPR003441NAC domain
PROSITE profilePS5100557.15461219IPR003441NAC domain
PfamPF023659.6E-2862189IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MRDSLMHRSL ISKFDKLIPK TQGEECNAIK VKPLKSYPHV QSGAVATASP VVVMGSSNGG  60
VPPGFRFHPT DEELLHYYLK KKVSFQKFDM EVIREVDLNK MEPWDLQERC RIGSTPQNEW  120
YFFSHKDRKY PTGSRTNRAT SAGFWKATGR DKCIRNTYRK IGMRKTLVFY RGRAPHGQKT  180
DWIMHEYRLE DGDDPQGNTS VSIQINIEDG WVVCRVFKKK NLFKVGNNGG SSINSSDQQL  240
NTSSSSQPRS FMHRSSDQYL VRHQHHNFEL NKAELARHYP HMQTPQYSLF QPQTLVQPHK  300
PLNYEFAAAP AALPPDPPVM IKQLMSRDCE SGSESLRYQA CEPGLEVGTC EPSQPMGVPG  360
RDEGMNEWSM LDRLVSASHM GHEDSSKGVR FEETNATAVH PMNQLSLRGE MDFWGYGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-516122115170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017981144.10.0PREDICTED: protein BEARSKIN2
SwissprotQ9SV871e-157BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A061FQY90.0A0A061FQY9_THECC; NAC domain protein, IPR003441
STRINGEOY169540.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52132648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-148NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]