PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG035362t2
Common NameTCM_035362
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 555aa    MW: 61908.1 Da    PI: 4.8561
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG035362t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.63.1e-1391865543374
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       + L+ecA ++s+g+ ++a+a+++ l++++s +gdp qR+aay++e+Laar+a+s++ lykal+++e +   ss++laa+++++ev+P++kf++
  Thecc1EG035362t2 186 QMLIECAAVLSEGNIKEASAIINDLRQMVSIQGDPPQRIAAYMVEGLAARMAESGKYLYKALRCKEPP---SSDRLAAMQILFEVCPCFKFGF 275
                       79*****************************************************************9...9********************* PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                       ++aN aI ea++ e+rvHiiDfdi+qG Q+++L+q++a+Rp++pp+lR+Tgv++pes+   +  l  +g rL+k+Ae+lgvpfef++ va+r+
  Thecc1EG035362t2 276 MAANGAIIEAFKDEKRVHIIDFDINQGSQYITLIQTIAKRPGKPPHLRLTGVDDPESVqrLNGGLAIVGLRLEKLAEALGVPFEFQA-VASRT 367
                       ********************************************************99777889***********************.7**** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       + +++++L+++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++F+ rf+ea +yysa+f+sl+a+lpres
  Thecc1EG035362t2 368 SLVTPSMLDCRPGEALIVNFAFQLHHMPDESVSTINQRDQLLRMVKSLNPKLVTVVEQDVNTNTSPFFPRFVEAYSYYSAVFESLDATLPRES 460
                       ********************************************************************************************* PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       ++r++vEr++l+r+ivn+vaceg+er+er e ++kWr+r+++aGF++ p+s ++ + ++ l+r++ ++ y+++e+ g l +gW+d++L+++Sa
  Thecc1EG035362t2 461 QDRMNVERQCLARDIVNIVACEGEERIERYEVAGKWRARMMMAGFSSCPMSPNVIDMIRKLIREYCDR-YKLKEDLGVLHFGWEDKSLIVASA 552
                       ******************************************************************66.************************ PP

              GRAS 373 Wr 374
                       Wr
  Thecc1EG035362t2 553 WR 554
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.392158535IPR005202Transcription factor GRAS
PfamPF035141.1E-136186554IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MSLVRSAEPA TAAYGNTKLY SLRGSDSSGL SAQIFGSDKH RPVYITDSYS NESYEKYFLD  60
SPTEELIHPS SSGISGSSIR PKDVSSYQLR DYLEIQSPET LDSDTDKMKL KLQELERALL  120
ADNDVDEDDD MFGTGISMEI DGEWSDPIRT ESLHDSPKES SSSDSNLSST SSNKDVSHVS  180
SRSPKQMLIE CAAVLSEGNI KEASAIINDL RQMVSIQGDP PQRIAAYMVE GLAARMAESG  240
KYLYKALRCK EPPSSDRLAA MQILFEVCPC FKFGFMAANG AIIEAFKDEK RVHIIDFDIN  300
QGSQYITLIQ TIAKRPGKPP HLRLTGVDDP ESVQRLNGGL AIVGLRLEKL AEALGVPFEF  360
QAVASRTSLV TPSMLDCRPG EALIVNFAFQ LHHMPDESVS TINQRDQLLR MVKSLNPKLV  420
TVVEQDVNTN TSPFFPRFVE AYSYYSAVFE SLDATLPRES QDRMNVERQC LARDIVNIVA  480
CEGEERIERY EVAGKWRARM MMAGFSSCPM SPNVIDMIRK LIREYCDRYK LKEDLGVLHF  540
GWEDKSLIVA SAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6819055325378Protein SCARECROW
5b3h_A2e-6819055324377Protein SCARECROW
5b3h_D2e-6819055324377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019339.20.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A061FGU20.0A0A061FGU2_THECC; SCARECROW-like 1 isoform 2
TrEMBLA0A061FPV50.0A0A061FPV5_THECC; SCARECROW-like 1 isoform 1
STRINGEOY165640.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]