PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG035362t1
Common NameTCM_035362
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 571aa    MW: 63856.2 Da    PI: 4.822
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG035362t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.53.3e-1392025703374
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       + L+ecA ++s+g+ ++a+a+++ l++++s +gdp qR+aay++e+Laar+a+s++ lykal+++e +   ss++laa+++++ev+P++kf++
  Thecc1EG035362t1 202 QMLIECAAVLSEGNIKEASAIINDLRQMVSIQGDPPQRIAAYMVEGLAARMAESGKYLYKALRCKEPP---SSDRLAAMQILFEVCPCFKFGF 291
                       79*****************************************************************9...9********************* PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                       ++aN aI ea++ e+rvHiiDfdi+qG Q+++L+q++a+Rp++pp+lR+Tgv++pes+   +  l  +g rL+k+Ae+lgvpfef++ va+r+
  Thecc1EG035362t1 292 MAANGAIIEAFKDEKRVHIIDFDINQGSQYITLIQTIAKRPGKPPHLRLTGVDDPESVqrLNGGLAIVGLRLEKLAEALGVPFEFQA-VASRT 383
                       ********************************************************99777889***********************.7**** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       + +++++L+++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++F+ rf+ea +yysa+f+sl+a+lpres
  Thecc1EG035362t1 384 SLVTPSMLDCRPGEALIVNFAFQLHHMPDESVSTINQRDQLLRMVKSLNPKLVTVVEQDVNTNTSPFFPRFVEAYSYYSAVFESLDATLPRES 476
                       ********************************************************************************************* PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       ++r++vEr++l+r+ivn+vaceg+er+er e ++kWr+r+++aGF++ p+s ++ + ++ l+r++ ++ y+++e+ g l +gW+d++L+++Sa
  Thecc1EG035362t1 477 QDRMNVERQCLARDIVNIVACEGEERIERYEVAGKWRARMMMAGFSSCPMSPNVIDMIRKLIREYCDR-YKLKEDLGVLHFGWEDKSLIVASA 568
                       ******************************************************************66.************************ PP

              GRAS 373 Wr 374
                       Wr
  Thecc1EG035362t1 569 WR 570
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.392174551IPR005202Transcription factor GRAS
PfamPF035141.1E-136202570IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MYQDSFYNAT IQRVETMSLV RSAEPATAAY GNTKLYSLRG SDSSGLSAQI FGSDKHRPVY  60
ITDSYSNESY EKYFLDSPTE ELIHPSSSGI SGSSIRPKDV SSYQLRDYLE IQSPETLDSD  120
TDKMKLKLQE LERALLADND VDEDDDMFGT GISMEIDGEW SDPIRTESLH DSPKESSSSD  180
SNLSSTSSNK DVSHVSSRSP KQMLIECAAV LSEGNIKEAS AIINDLRQMV SIQGDPPQRI  240
AAYMVEGLAA RMAESGKYLY KALRCKEPPS SDRLAAMQIL FEVCPCFKFG FMAANGAIIE  300
AFKDEKRVHI IDFDINQGSQ YITLIQTIAK RPGKPPHLRL TGVDDPESVQ RLNGGLAIVG  360
LRLEKLAEAL GVPFEFQAVA SRTSLVTPSM LDCRPGEALI VNFAFQLHHM PDESVSTINQ  420
RDQLLRMVKS LNPKLVTVVE QDVNTNTSPF FPRFVEAYSY YSAVFESLDA TLPRESQDRM  480
NVERQCLARD IVNIVACEGE ERIERYEVAG KWRARMMMAG FSSCPMSPNV IDMIRKLIRE  540
YCDRYKLKED LGVLHFGWED KSLIVASAWR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-6820656925378Protein SCARECROW
5b3h_A3e-6820656924377Protein SCARECROW
5b3h_D3e-6820656924377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019339.20.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A061FPV50.0A0A061FPV5_THECC; SCARECROW-like 1 isoform 1
STRINGEOY165640.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69532744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]