PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG035123t1
Common NameTCM_035123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 152aa    MW: 17051.3 Da    PI: 7.3695
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG035123t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.51.4e-4051041100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaC++lrr+C++dC+++pyfp+++p++f  +h+++Gasnv kll++lp++ r +a++sl++eA++r++dPvyG+vg+i+ lqqq++++ ++
  Thecc1EG035123t1   5 RCAACRYLRRRCPPDCIFSPYFPSNNPQRFVSIHRIYGASNVAKLLQQLPTHLRAEAADSLYFEAQCRVEDPVYGCVGLIFLLQQQIHNAVSQ 97 
                       6******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++e
  Thecc1EG035123t1  98 LAKTQAE 104
                       **99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4154105IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-405102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MNSGRCAACR YLRRRCPPDC IFSPYFPSNN PQRFVSIHRI YGASNVAKLL QQLPTHLRAE  60
AADSLYFEAQ CRVEDPVYGC VGLIFLLQQQ IHNAVSQLAK TQAEIAVLKS QAQHPQAQQV  120
EVEPEFNNFL QQQLDYVADL NFSNQGSSGF M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019079.11e-109LOB domain-containing protein 23
SwissprotP594682e-55LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A061FP581e-109A0A061FP58_THECC; LOB domain-containing protein 23
STRINGPOPTR_0012s13910.19e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-45LOB domain-containing protein 24
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]