PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034804t1
Common NameTCM_034804
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 418aa    MW: 45898 Da    PI: 4.8564
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034804t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.82.3e-08244290450
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                        k+ rr  +NR AA rsR+RKk+ ++ Le k+  Le+e ++L   l+
  Thecc1EG034804t1 244 AKKRRRQLRNRDAAVRSRERKKMHVKDLEMKSRYLEGECRRLSRMLQ 290
                       5899***********************************99987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-11239303No hitNo description
SMARTSM003389.3E-5241305IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.082243300IPR004827Basic-leucine zipper domain
PfamPF001703.7E-8244300IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.31E-10245303No hitNo description
CDDcd147042.67E-17246297No hitNo description
PROSITE patternPS000360248263IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MARVDGGGGG RVGGGGVVWC YRPDTGTFDS DEMMITEGEN KYVVIASTGS TWQVLTCNAC  60
RRIMAVKDNE EPAVAVRKRV EKAFDFSFIE ARPLLPRPFM EGDLETIGEI NWDTLFLELD  120
SSDFANIFEN SSIEPEPVTQ PLQPLSTPSP DGDAVVSSCI GEIERVLMED DHFDKEVQTQ  180
SVSDDFLAEV LGDSPLSGGG EVIDGAAADV PDAADVPDAS DVADASFFKQ NDSDNNIHND  240
DHIAKKRRRQ LRNRDAAVRS RERKKMHVKD LEMKSRYLEG ECRRLSRMLQ CFIAENQALR  300
LTLHKGCAFD ASSAKQESAV LLLESLLLGS LLWFLGIMCL FTLPTLPKSL PEAVPLENEE  360
KRGPERVAPR GAGSNLVGQS FVKSRRCKAS KTRIKEFHVS GILARACGSH LSLVFPF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1815GGRVGGGG
2245264KRRRQLRNRDAAVRSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017981823.10.0PREDICTED: bZIP transcription factor 60
RefseqXP_017981824.10.0PREDICTED: bZIP transcription factor 60
TrEMBLA0A061FMW60.0A0A061FMW6_THECC; Basic region/leucine zipper motif 60, putative
STRINGEOY158640.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.15e-21basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]