PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG033728t3
Common NameTCM_033728
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 317aa    MW: 36089.5 Da    PI: 7.3686
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG033728t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.46.8e-54101391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL+ k ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk
  Thecc1EG033728t3  10 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKdKcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDK 101
                       69****************************.9***************943444443456********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++  +++++g++ktLvfy+grap+g+ktdW+mheyrl
  Thecc1EG033728t3 102 AIHLCNSKKIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 139
                       ************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-606159IPR003441NAC domain
PROSITE profilePS5100558.14410159IPR003441NAC domain
PfamPF023653.6E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MLPGNGQLSV PPGFRFHPTD EELLYYYLRK KVSYEAIDLD VIREVDLNKL EPWDLKDKCR  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIHLCNSKK IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLD DDDSDVQEDG WVVCRVFKKK NHSRGNFQPE FSQEESFTHI  180
KTVASSAQLE TRHNHLQALY DFSFDGSMQL PHLFSPESAV ASSFISPVSL NSTDIECSQN  240
LLRLTSSGGC GLVQQERYNG EWSFLDKLLA THHLSVDQQH SQGKCTPSSQ VDVGTSTQKF  300
PFQYLGCEAD ILKFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-51716414170NO APICAL MERISTEM PROTEIN
1ut4_B3e-51716414170NO APICAL MERISTEM PROTEIN
1ut7_A3e-51716414170NO APICAL MERISTEM PROTEIN
1ut7_B3e-51716414170NO APICAL MERISTEM PROTEIN
3swm_A3e-51716417173NAC domain-containing protein 19
3swm_B3e-51716417173NAC domain-containing protein 19
3swm_C3e-51716417173NAC domain-containing protein 19
3swm_D3e-51716417173NAC domain-containing protein 19
3swp_A3e-51716417173NAC domain-containing protein 19
3swp_B3e-51716417173NAC domain-containing protein 19
3swp_C3e-51716417173NAC domain-containing protein 19
3swp_D3e-51716417173NAC domain-containing protein 19
4dul_A3e-51716414170NAC domain-containing protein 19
4dul_B3e-51716414170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007022814.20.0PREDICTED: protein SOMBRERO
RefseqXP_007022815.20.0PREDICTED: protein SOMBRERO
SwissprotQ9MA171e-125SMB_ARATH; Protein SOMBRERO
TrEMBLA0A061FBQ80.0A0A061FBQ8_THECC; NAC domain transcriptional regulator superfamily protein isoform 1
STRINGEOY143380.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-118NAC family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  3. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  4. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  5. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]