PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG032557t1
Common NameTCM_032557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 172aa    MW: 18798.4 Da    PI: 8.126
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG032557t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260148.22.2e-46131121100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca+dCv+apyfpae+p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+++
  Thecc1EG032557t1  13 PCAACKLLRRRCAQDCVFAPYFPAEEPQKFASVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDSLQTQ 105
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       lal+++e
  Thecc1EG032557t1 106 LALAQAE 112
                       **99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.37112113IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKENGRKHGT LSPCAACKLL RRRCAQDCVF APYFPAEEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID SLQTQLALAQ AEVVHMRMRQ  120
FVSTSNAGTS SPENLTPAAA ASSKFMPSQA KSFFCVDMVD QANMAESLWS Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007022340.11e-126LOB domain-containing protein 4
SwissprotQ9SHE91e-74LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A061F9431e-126A0A061F943_THECC; LOB domain-containing protein 4
STRINGVIT_19s0027g01120.t014e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.18e-69LOB domain-containing protein 4
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]