PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG032393t1
Common NameTCM_032393
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 344aa    MW: 38688.7 Da    PI: 8.3496
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG032393t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.21.7e-49691963128
               NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       pGfrFhPtdeel+++yL++kv++k++++ e ik++diyk++PwdLpk  +++e++ yfF+kr +ky+++ r+nr+t sg+Wkatg dk+v+s+
  Thecc1EG032393t1  69 PGFRFHPTDEELLSFYLQRKVDKKPIKI-ELIKQMDIYKCDPWDLPKPSSEGESDSYFFCKRGRKYRNSIRPNRVTGSGFWKATGIDKPVYSH 160
                       9***************************.89***************8777888999************************************9 PP

               NAM  96 ...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++  +glkktLv+y+g+a kg+ktdW+mhe+rl
  Thecc1EG032393t1 161 ggeGHVCIGLKKTLVYYRGSAGKGTKTDWMMHEFRL 196
                       5544445***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5463225IPR003441NAC domain
PROSITE profilePS5100551.15967225IPR003441NAC domain
PfamPF023651.3E-2469196IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MPFIGFGNDM ICFGDGPCVF FHPEGSPKLK LQTIKLFVSY TAPGIFQGHK GKMNVQDGTA  60
KMDEDVPLPG FRFHPTDEEL LSFYLQRKVD KKPIKIELIK QMDIYKCDPW DLPKPSSEGE  120
SDSYFFCKRG RKYRNSIRPN RVTGSGFWKA TGIDKPVYSH GGEGHVCIGL KKTLVYYRGS  180
AGKGTKTDWM MHEFRLPSND NNTSLSDPQY AQEAEVWTIC RIFKRNASHR KLYTPDWREV  240
AAKRHSTNRT SSQTFTVESN NVENYISFGD PILQHQAVNQ INGRSQWHAA AAAAAADQLS  300
TTAQPLLIAP SSSFSNPETD LVTYANWDEL RSVVEFALDP SLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-47532314171NO APICAL MERISTEM PROTEIN
1ut4_B9e-47532314171NO APICAL MERISTEM PROTEIN
1ut7_A9e-47532314171NO APICAL MERISTEM PROTEIN
1ut7_B9e-47532314171NO APICAL MERISTEM PROTEIN
3swm_A9e-47532317174NAC domain-containing protein 19
3swm_B9e-47532317174NAC domain-containing protein 19
3swm_C9e-47532317174NAC domain-containing protein 19
3swm_D9e-47532317174NAC domain-containing protein 19
3swp_A9e-47532317174NAC domain-containing protein 19
3swp_B9e-47532317174NAC domain-containing protein 19
3swp_C9e-47532317174NAC domain-containing protein 19
3swp_D9e-47532317174NAC domain-containing protein 19
4dul_A9e-47532314171NAC domain-containing protein 19
4dul_B9e-47532314171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00353DAPTransfer from AT3G12910Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017980098.10.0PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK553e-84NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A061F8U30.0A0A061F8U3_THECC; NAC domain transcriptional regulator superfamily protein, putative
STRINGEOY137450.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12910.14e-91NAC family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  3. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  4. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  5. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  6. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]