PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG032389t1
Common NameTCM_032389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 294aa    MW: 33361.3 Da    PI: 8.8763
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG032389t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.37.4e-50181453128
               NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       pGfrFhPtdeelv +yL++kv++k++++ e ik++diyk++PwdLpk    +++e yfF+kr +ky++++r+nr+t sg+Wkatg dk+v+s+
  Thecc1EG032389t1  18 PGFRFHPTDEELVGFYLRRKVDRKPIRM-ELIKTIDIYKYDPWDLPKPSIVGQSESYFFCKRGRKYRNSTRPNRVTGSGFWKATGIDKPVYSQ 109
                       9***************************.99***************75556889**************************************9 PP

               NAM  96 ...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++ +glkktLv+y+g+a kg+ktdW+mhe+rl
  Thecc1EG032389t1 110 ggqGHACIGLKKTLVYYRGTAGKGTKTDWMMHEFRL 145
                       5544445***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5516177IPR003441NAC domain
PROSITE profilePS5100551.73516177IPR003441NAC domain
PfamPF023651.5E-2518145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MNIVQATGDN KDEDAPLPGF RFHPTDEELV GFYLRRKVDR KPIRMELIKT IDIYKYDPWD  60
LPKPSIVGQS ESYFFCKRGR KYRNSTRPNR VTGSGFWKAT GIDKPVYSQG GQGHACIGLK  120
KTLVYYRGTA GKGTKTDWMM HEFRLPSNDS NTNTSLSNPK SIAQEAEVWT ICRIFKRNAS  180
QRKYTPDWRE VAAKRPSTST PSSQTCSVES NSHETTYISF GSEVVQHYDE KPVVNHINGR  240
SQWHADQLST IAQPSSMASS SSFSNCPEND FFTHANWDEL KSVLDFAFDP FPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-481818319171NO APICAL MERISTEM PROTEIN
1ut4_B4e-481818319171NO APICAL MERISTEM PROTEIN
1ut7_A4e-481818319171NO APICAL MERISTEM PROTEIN
1ut7_B4e-481818319171NO APICAL MERISTEM PROTEIN
3swm_A5e-481818322174NAC domain-containing protein 19
3swm_B5e-481818322174NAC domain-containing protein 19
3swm_C5e-481818322174NAC domain-containing protein 19
3swm_D5e-481818322174NAC domain-containing protein 19
3swp_A5e-481818322174NAC domain-containing protein 19
3swp_B5e-481818322174NAC domain-containing protein 19
3swp_C5e-481818322174NAC domain-containing protein 19
3swp_D5e-481818322174NAC domain-containing protein 19
4dul_A4e-481818319171NAC domain-containing protein 19
4dul_B4e-481818319171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007022218.20.0PREDICTED: transcription factor JUNGBRUNNEN 1 isoform X2
SwissprotQ9SK555e-87NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A061FA310.0A0A061FA31_THECC; NAC domain protein, IPR003441
STRINGEOY137430.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.15e-83NAC domain containing protein 42
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  3. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  4. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  5. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  6. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]