PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG032355t1
Common NameTCM_032355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GeBP
Protein Properties Length: 384aa    MW: 42775 Da    PI: 5.2061
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG032355t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573125.13.2e-39165261298
            DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskk 94 
                       lfqrl+se+Dei++L+G++d+ ak+g++p +d++afy+fvkksi+++v+k ql++KirrL+kKf+++  k k+g++++fsk h+qk+f+lskk
  Thecc1EG032355t1 165 LFQRLFSEDDEIAVLKGMLDYYAKKGADPCADMNAFYDFVKKSIHIDVTKAQLMDKIRRLRKKFENNAVKGKKGEDKTFSKVHEQKAFDLSKK 257
                       79******************************************************************************************* PP

            DUF573  95 iWgs 98 
                       iWg+
  Thecc1EG032355t1 258 IWGK 261
                       **95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.9E-34166260IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MARKRSNPIE DPPTASSSEE EKEEETSSEE EEGSSSEEEE EEPKTQTTSQ NQKTQPPKKP  60
DIATAATPGD ESDDSDTDSE SESDTDSQTP KPIATKPMEE ASNTKKPRSK PLASPIKASS  120
TKRPSDSEQE PKDVKRAKKK AGEEVTEVAV VEEVKKTGED AKKQLFQRLF SEDDEIAVLK  180
GMLDYYAKKG ADPCADMNAF YDFVKKSIHI DVTKAQLMDK IRRLRKKFEN NAVKGKKGED  240
KTFSKVHEQK AFDLSKKIWG KEGISGKTES SAVKSNGKTK GNTKALPVVK PEIFSPEKNV  300
EPMDLDKKSK SVASFFDKSI GLAGMEEKIL KNGLEIIGAE KRAALEEKWR KLQIAELELF  360
LQRSELIKEE AKMLLEFYKS EDK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007022191.10.0DNA-binding storekeeper protein-related transcriptional regulator, putative
TrEMBLA0A061F9M70.0A0A061F9M7_THECC; DNA-binding storekeeper protein-related transcriptional regulator, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.19e-42DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]