PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG031955t1
Common NameTCM_031955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family BES1
Protein Properties Length: 326aa    MW: 34902.9 Da    PI: 8.2895
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG031955t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822213.84.3e-6621451150
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       ++++r ptwkErEnnkrRERrRRaiaaki++GLR+ Gnyklpk++DnneVlkALc+eAGw+ve DGttyrkg+kp e+++++g sa++sp+ss
  Thecc1EG031955t1   2 TSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMFGNYKLPKHCDNNEVLKALCNEAGWTVESDGTTYRKGCKPVERMDIVGGSATMSPCSS 94 
                       5899***************************************************************************************** PP

            DUF822  94 lqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                       ++        +sp++sy++sp sssfpsp+s++ + + +   +sl+p+l++ls++sss+
  Thecc1EG031955t1  95 YH--------PSPCASYNPSPVSSSFPSPASSSYVVNPNGdgNSLIPWLKNLSSASSSA 145
                       **........*******************9999887765577**********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.0E-663139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FSGLRMFGNY KLPKHCDNNE VLKALCNEAG  60
WTVESDGTTY RKGCKPVERM DIVGGSATMS PCSSYHPSPC ASYNPSPVSS SFPSPASSSY  120
VVNPNGDGNS LIPWLKNLSS ASSSASSSKL PHLYIHGGSI SAPVTPPLSS PTARTPRIKT  180
DWEEQSARPG WSAQQHSLLP SSTPPSPGRQ IVPDPEWFAG LRIPHSGPTS PTFSLVSTNP  240
FGFKEEVLAG GGSRMWTPGQ SGTCSPAIAA GSDHTADVPM SEVISDEFAF GSNATGLVKP  300
WEGERIHEEC GSDDLELTLG SSRTR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431160.0AC243116.1 Gossypium raimondii clone GR__Ba0066P11-hvl, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021866.10.0BES1/BZR1
SwissprotQ9ZV881e-145BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A061F8K90.0A0A061F8K9_THECC; BES1/BZR1
STRINGVIT_19s0014g00870.t011e-172(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-125BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]