PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG031595t2
Common NameTCM_031595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family SBP
Protein Properties Length: 259aa    MW: 28941.5 Da    PI: 8.1615
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG031595t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.92.9e-43113189278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       Cqve+C  dls+ak+yhrrhkvCe+h+kap v+v+gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a
  Thecc1EG031595t2 113 CQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSA 189
                       **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.6E-36106174IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.154110187IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-40111190IPR004333Transcription factor, SBP-box
PfamPF031103.3E-33113186IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
LVVLNFFFST FFFSFSLFSF ISSESHKLSS QHFITSPLYI SPSPAMETTD FRRKSALKTK  60
MNKGFIAEDL DDDMEEEEEE GVGDHGFPDD EKKKKAYGKR GSSGGAGVSP PSCQVEKCGL  120
DLSDAKRYHR RHKVCEIHAK APFVVVAGLR QRFCQQCSRF HELSEFDEAK RSCRRRLAGH  180
NERRRKSSAE SSTEGSSRKG MSSQLRESQC RQADDQRARV PILHAPSLLS ANGLCISLCT  240
GTYYTTLEDS ITISGIEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-38101186184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223131e-133KJ622313.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021544.10.0Squamosa promoter binding protein-like 3 isoform 2, partial
TrEMBLA0A061FF190.0A0A061FF19_THECC; Squamosa promoter binding protein-like 3 isoform 2 (Fragment)
STRINGPOPTR_0001s40870.11e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.16e-41squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]