PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG031364t1
Common NameTCM_031364
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 344aa    MW: 38257.8 Da    PI: 8.6837
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG031364t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.92.8e-51141391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF Ptdeel+v+yL+++v+g++++l ++i e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ +gyWkatg+dk ++
  Thecc1EG031364t1  14 LPPGFRFYPTDEELLVQYLCRQVAGHHFSL-QIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGTGYWKATGTDKVIT 105
                       79***************************9.89***************7777799*************************************9 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Thecc1EG031364t1 106 T-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                       9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-6510163IPR003441NAC domain
PROSITE profilePS5100559.49514162IPR003441NAC domain
PfamPF023652.1E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGVPETDPLA QLSLPPGFRF YPTDEELLVQ YLCRQVAGHH FSLQIIGEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GTGYWKATGT DKVITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLI EASRKNGSSK LDDWVLCRIY KKNSSAQKPL SSVASKEHSN  180
NGSSSSSSSQ LDDMLESFPE LDDRYFGLPR MNSLKTLQND AKTGFHNLGS GNLDWASLAG  240
LNSVPELVPS GQTQTQSQGI PGYGNNDVYV PTMQPTLCQM DTSTNKIGNS VDEEVQSGLR  300
TQRADNSGFF QQNSSVLTQN FSNSMDPYGF RYPTHPGGFG FRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11111684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11111684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11111684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-11111684171NO APICAL MERISTEM PROTEIN
3swm_A1e-11111687174NAC domain-containing protein 19
3swm_B1e-11111687174NAC domain-containing protein 19
3swm_C1e-11111687174NAC domain-containing protein 19
3swm_D1e-11111687174NAC domain-containing protein 19
3swp_A1e-11111687174NAC domain-containing protein 19
3swp_B1e-11111687174NAC domain-containing protein 19
3swp_C1e-11111687174NAC domain-containing protein 19
3swp_D1e-11111687174NAC domain-containing protein 19
4dul_A1e-11111684171NAC domain-containing protein 19
4dul_B1e-11111684171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021328.20.0PREDICTED: NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-154JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A061F7J60.0A0A061F7J6_THECC; NAC domain class transcription factor isoform 1
STRINGGorai.002G073700.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-143NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  4. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]