PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG031363t1
Common NameTCM_031363
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 348aa    MW: 38162.9 Da    PI: 8.4258
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG031363t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.56.4e-54151421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl
  Thecc1EG031363t1  15 LPPGFRFHPTDEELVVHYLKKKASSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVL 106
                       79****************************.88***************988899*************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Thecc1EG031363t1 107 TSgGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                       9977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-657176IPR003441NAC domain
PROSITE profilePS5100562.05115176IPR003441NAC domain
PfamPF023653.1E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MESTDSSTGS QQPNLPPGFR FHPTDEELVV HYLKKKASSA PLPVAIIAEV DLYKFDPWEL  60
PAKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPVLTSGG TQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLADNKASNK PPGCDLGNKK NSLRLDDWVL CRIYKKNNTH  180
RPMDHDKDDS MDEMLGPIPP SISIGSQHNA KFQLATKGTS FGTLLENQEH SLFEGMMAGS  240
DGINSGSISQ LGCSSSKPDL SMVNPLKRTV PSLFWTDEDT AGPSTSKRFH GDSNDGSMEK  300
TDGNGSIATL LSQLPQTPPL QQQTMLGSMG DGIFRPPYQL SGLNWYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-741417814170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472300.0KC847230.1 Gossypium hirsutum NAC domain protein NAC53 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021327.10.0PREDICTED: NAC transcription factor 56
SwissprotQ9LD441e-131NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A061F8180.0A0A061F818_THECC; NAC domain protein, IPR003441
STRINGEOY128520.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-125NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]