PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG031132t4
Common NameTCM_031132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 593aa    MW: 65785.2 Da    PI: 6.6062
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG031132t4genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.36.2e-1312195881373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL+ cA+a+s++++   ++l+a+ ++ +s  g+p+qRl ay++eAL ar   s+s++y+a +++e +    ++ l+++++++e++P+lkf
  Thecc1EG031132t4 219 LKQLLIVCAQALSENNMDDFDKLIAKARNAVSICGEPIQRLGAYMVEALVARKEASGSNIYRARRCREPE---GKDLLSYMQILYEICPYLKF 308
                       679******************************************************************9...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       ++++aN aI ea  +e+r+HiiDf i+qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  +   le++g+rLa + e++++p+ef+  v  
  Thecc1EG031132t4 309 GYMAANGAIAEACRTEDRIHIIDFHIGQGTQWVTLLQALAARPGGAPHVRITGIDDPLSKyaRGGGLEAVGRRLAALSEKFNIPVEFHG-VPV 400
                       ********************************************************999989999************************.688 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                          d++  +L+v+pgEalaVn+ lqlh+++desv+++++rd +L++vkslsPkv ++veqe+++n+++Fl rf+e+l+yy a+f+s++++lpr
  Thecc1EG031132t4 401 FAPDITRGMLDVRPGEALAVNFPLQLHHTPDESVDVNNPRDGLLRMVKSLSPKVTTLVEQESNTNTAPFLPRFIETLDYYLAMFESIDETLPR 493
                       89999**************************************************************************************** PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       + +eri+vE+++l+r+ivnv+aceg+er+erhe ++kW++rl++aGF+++pls+++++ +++llr ++ + y++ e++g+++lgWkdr+L+s+
  Thecc1EG031132t4 494 DRKERINVEQHCLARDIVNVIACEGKERVERHELFGKWKSRLTMAGFRQYPLSSYVNSVIRSLLRCYS-KHYKLVEKDGAMLLGWKDRNLISA 585
                       *****************************************************************999.55********************** PP

              GRAS 371 SaW 373
                       SaW
  Thecc1EG031132t4 586 SAW 588
                       *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.924193570IPR005202Transcription factor GRAS
PfamPF035142.1E-128219588IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
QLFSYGVTGA SLSYSTSYST VPSIPNRLFS SLKSDIGNSP NSPFSSQFDS PFSTQFDCDT  60
NTTLSDSQEQ HSSTENLSGL SPSCNSSFES NTYCHKLSPS LDCKREILPL CSGGTSYIQD  120
ANSSHKIIYT LQELETALMA PDADEEVTTP NVSCGESSRP QTTGQRSRAW SQEHQGSLVL  180
QPQTSFVSRH RQSTEVSHAE KRQKAIGDLS LQDIPPGNLK QLLIVCAQAL SENNMDDFDK  240
LIAKARNAVS ICGEPIQRLG AYMVEALVAR KEASGSNIYR ARRCREPEGK DLLSYMQILY  300
EICPYLKFGY MAANGAIAEA CRTEDRIHII DFHIGQGTQW VTLLQALAAR PGGAPHVRIT  360
GIDDPLSKYA RGGGLEAVGR RLAALSEKFN IPVEFHGVPV FAPDITRGML DVRPGEALAV  420
NFPLQLHHTP DESVDVNNPR DGLLRMVKSL SPKVTTLVEQ ESNTNTAPFL PRFIETLDYY  480
LAMFESIDET LPRDRKERIN VEQHCLARDI VNVIACEGKE RVERHELFGK WKSRLTMAGF  540
RQYPLSSYVN SVIRSLLRCY SKHYKLVEKD GAMLLGWKDR NLISASAWHC DS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A9e-6322658825377Protein SCARECROW
5b3h_D9e-6322658825377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021110.20.0PREDICTED: chitin-inducible gibberellin-responsive protein 1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A061F7I00.0A0A061F7I0_THECC; GRAS family transcription factor isoform 1
STRINGEOY126350.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-179GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]