PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG030735t1
Common NameTCM_030735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 567aa    MW: 61161.4 Da    PI: 6.7303
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG030735t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.32.7e-32220277260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Thecc1EG030735t1 220 DDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 277
                       8****************************************.***************85 PP

2WRKY106.31.6e-33383441159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Thecc1EG030735t1 383 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 441
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-27217278IPR003657WRKY domain
SuperFamilySSF1182904.05E-25217278IPR003657WRKY domain
SMARTSM007741.6E-34219277IPR003657WRKY domain
PROSITE profilePS5081122.837220278IPR003657WRKY domain
PfamPF031067.5E-25220276IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-37368443IPR003657WRKY domain
SuperFamilySSF1182902.22E-29375443IPR003657WRKY domain
PROSITE profilePS5081138.825378443IPR003657WRKY domain
SMARTSM007743.1E-39383442IPR003657WRKY domain
PfamPF031063.4E-26384441IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MVMEEQILAS SAAAATQHVQ ATCDPSGSGG SGGARYKLVA PAKLPISRSA CITIPPGLSP  60
SSFLESPVLL SDVKAEPSPT TGSLIKPQAV HASVASSTYS AAPVCSNTFD ERNSSCFEFR  120
PHPRSNMAPA DLNHQRSEQS LQIQGQYQTI SFNSSSSVKS EMAGSSNELS LSVPVHTATS  180
MASATAEVDV DELNQIGNPN SGIQAGQSDH RSGGPSVPSD DGYNWRKYGQ KQVKGSEFPR  240
SYYKCTHPNC EVKKLFERSH DGQITEIIYK GTHDHPKPQP SRRYSSGNIM PGQEERSDKV  300
SSFTGRDDKS SSIYGQMAYS IEPNSTADLS PVTANDDNID EVDDDDPFSK RRKMDGGVDI  360
TPVVKPIREP RVVVQTLSEV DILDDGYRWR KYGQKVVRGN PNPRSYYKCT NAGCPVRKHV  420
ERASHDPKAV ITTYEGKHNH DVPTARTSSH DTAGPVAVNG PSRIRSEEND AISLDLGVGI  480
SSAPENSSNE HQQLHSELVQ THAQTGGSSF KLIQAAPITT YYGVLNGGRT QYGSRENPSE  540
GRGVEILPLN HSYAYPQSMG RILTGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-37220443877Probable WRKY transcription factor 4
2lex_A7e-37220443877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6697620.0KF669762.1 Gossypium hirsutum WRKY transcription factor 14 (WRKY14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007020620.20.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A061F4840.0A0A061F484_THECC; WRKY family transcription factor family protein
STRINGEOY121450.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]