PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG030733t4
Common NameTCM_030733
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 541aa    MW: 60140 Da    PI: 5.7692
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG030733t4genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS453.41.4e-1381695391374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+elL +cA+a++++d+++a++l+++l++++s +g+p+qRl ay++e+L arla+s+s++ykal+++e +   s+e l+++++++e++P++kf
  Thecc1EG030733t4 169 LKELLCACAKAIDNNDMHMADWLMTQLRQMVSVSGEPIQRLGAYMLEGLVARLASSGSSIYKALRCKEPA---STELLSYMHILYEICPYFKF 258
                       5799*****************************************************************9...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       +++ aN aI ea++ e+rvHiiDf+i qG+QW++L++aLa+Rp+gpps+RiTg+++p+s   +   le +g+rL k+Ae+++vpfef+  +a 
  Thecc1EG030733t4 259 GYMSANGAIAEAMKDESRVHIIDFQIAQGAQWLTLIHALAARPGGPPSIRITGIDDPTSAyaRGGGLEIVGQRLLKLAESCKVPFEFHS-AAI 350
                       **********************************************************9999999************************.899 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       + ++++le+L ++pgEa+aVn+++ lh+++desv ++++rd++L+l kslsPkvv++veqea++n+++F+ rf e++++y a+f+s++ +lpr
  Thecc1EG030733t4 351 SGTEVQLENLGIQPGEAIAVNFAMTLHHMPDESVGTQNHRDRLLRLAKSLSPKVVTLVEQEANTNTAPFFPRFYETMNHYLAIFESIDGTLPR 443
                       9******************************************************************************************** PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       e++eri+vE+++l+reivn++aceg+er+erhe l+kWr+r+ +aGF+p pls+++++++k+ll+ + +  y++ee++g l+lgW++r++++ 
  Thecc1EG030733t4 444 EHKERINVEQHCLAREIVNIIACEGSERVERHELLGKWRSRFIMAGFTPSPLSSFVNATIKTLLQSYCD-KYTLEEKDGVLYLGWMNRAIITS 535
                       ********************************************************************5.5********************** PP

              GRAS 371 SaWr 374
                       +aWr
  Thecc1EG030733t4 536 CAWR 539
                       ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.471143520IPR005202Transcription factor GRAS
PfamPF035144.8E-136169539IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MQTSEKHKIS GKYFDQPVQE LESHCWPPNR SLDHYQSCSD DGGNGLQYSV QNLEQYCTLE  60
SSSSMQNSSS TASFSPSGSP VSQPNSQSYL SDVHHSPDNT CSSPVSGSCV TDNEHDLRHM  120
IRQLETAMLG TDSDNFDIHA INASGGATQI SIEEERWKYM MEMIARGDLK ELLCACAKAI  180
DNNDMHMADW LMTQLRQMVS VSGEPIQRLG AYMLEGLVAR LASSGSSIYK ALRCKEPAST  240
ELLSYMHILY EICPYFKFGY MSANGAIAEA MKDESRVHII DFQIAQGAQW LTLIHALAAR  300
PGGPPSIRIT GIDDPTSAYA RGGGLEIVGQ RLLKLAESCK VPFEFHSAAI SGTEVQLENL  360
GIQPGEAIAV NFAMTLHHMP DESVGTQNHR DRLLRLAKSL SPKVVTLVEQ EANTNTAPFF  420
PRFYETMNHY LAIFESIDGT LPREHKERIN VEQHCLAREI VNIIACEGSE RVERHELLGK  480
WRSRFIMAGF TPSPLSSFVN ATIKTLLQSY CDKYTLEEKD GVLYLGWMNR AIITSCAWRC  540
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-621735398375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007020614.20.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_007020616.20.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_017980057.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_017980058.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A061F5H80.0A0A061F5H8_THECC; Scarecrow-like transcription factor PAT1 isoform 1
STRINGEOY121390.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]