PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG030504t3
Common NameTCM_030504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 735aa    MW: 79340.4 Da    PI: 6.188
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG030504t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.1e-32319376260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y+g Hnh+k
  Thecc1EG030504t3 319 DDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSH-EGHITEIIYKGAHNHPK 376
                       8****************************************.***************85 PP

2WRKY103.71e-32531589159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  Thecc1EG030504t3 531 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCTVRKHVERASHDLKSVITTYEGKHNHD 589
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.537313377IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-28315377IPR003657WRKY domain
SuperFamilySSF1182907.06E-26316377IPR003657WRKY domain
SMARTSM007743.5E-36318376IPR003657WRKY domain
PfamPF031068.1E-25319375IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.5E-37516591IPR003657WRKY domain
SuperFamilySSF1182901.7E-28523591IPR003657WRKY domain
PROSITE profilePS5081138.664526591IPR003657WRKY domain
SMARTSM007741.5E-37531590IPR003657WRKY domain
PfamPF031066.6E-25532589IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MAGIDDNVAI IGDWIPPTPS PRTFFAALLG DDIGSKPVSE THGENKTEGL FLGSRGIMTA  60
ENSDNKDAHQ GHEQLKEFRS ISEQKSSSRG GLVERMAARA GFNAPRLNTE SIRSADLSLN  120
PEICSPYLTI PPGLSPTTLL ESPVFVSNSL AQPSPTTGKF PFIPNGNGRS SFSESSDKSK  180
DNYFEDINAS SFAFKPFAES NSSFLLGAMS KITPASVPQQ SFPNIEVSVQ SENPLPSQNV  240
DPGKVHSQNS NRPSLQADFS RSSTEKDTGS NNSADQRVFD PVGGTAENSP PLDEPQDEEG  300
DQRGSGDCMA GGVGSAPSDD GYNWRKYGQK QVKGSEYPRS YYKCTHPNCQ VKKKVERSHE  360
GHITEIIYKG AHNHPKPPPN RRSAIGSSNP LTDMQPEVPE QPGLQHGTDG DPVWATAQKG  420
TVAATHDWRH DSIEVTSSAP VGPEYGNVQA PNGTHFESGD AVDASSTFSN DEDEDDRGTH  480
GSVSLGYDGE GDESESKRRK IEAYAPEMSG ATRAIREPRV VVQTTSEVDI LDDGYRWRKY  540
GQKVVKGNPN PRSYYKCTSA GCTVRKHVER ASHDLKSVIT TYEGKHNHDV PAARSSSHVN  600
SATCSTVTAQ GASSVQTHVH RPEPSQLHNS MVRPASFGPY TLPGRQQLGP SPGFSFGMNQ  660
PGLANLAMAG LGPGQAKLPV LPVHPFMPQQ RQMNEMGFML PKGEPKMEPM SEPGLNLSNN  720
STVYQQIMSR LPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36319592878Probable WRKY transcription factor 4
2lex_A2e-36319592878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007020303.20.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_007020304.20.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_017980226.10.0PREDICTED: probable WRKY transcription factor 2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A061FBG50.0A0A061FBG5_THECC; WRKY DNA-binding protein 2 isoform 3
STRINGEOY118280.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79542740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  5. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]