PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG030302t1
Common NameTCM_030302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TALE
Protein Properties Length: 357aa    MW: 40029.9 Da    PI: 6.6347
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG030302t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-092853182255
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +yps++++  LA+++gL+++q+ +WF N+R ++
  Thecc1EG030302t1 285 WPYPSESQKIALAESTGLDQKQINNWFINQRKRH 318
                       69*****************************885 PP

2ELK41.13.6e-14238259122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK qLlrKYsgyLgsLkqEF+
  Thecc1EG030302t1 238 ELKGQLLRKYSGYLGSLKQEFM 259
                       9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.6E-20102146IPR005540KNOX1
PfamPF037901.7E-22104142IPR005540KNOX1
SMARTSM012567.8E-26151202IPR005541KNOX2
PfamPF037912.1E-20155201IPR005541KNOX2
PROSITE profilePS5121311.174238258IPR005539ELK domain
PfamPF037895.9E-11238259IPR005539ELK domain
SMARTSM011882.8E-8238259IPR005539ELK domain
PROSITE profilePS5007112.811258321IPR001356Homeobox domain
SuperFamilySSF466892.35E-19260335IPR009057Homeodomain-like
SMARTSM003891.9E-13260325IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-28263323IPR009057Homeodomain-like
CDDcd000861.12E-12270322No hitNo description
PfamPF059203.4E-17278317IPR008422Homeobox KN domain
PROSITE patternPS000270296319IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MEGGSNSTSC MIAFGHNSHG LCPMTMMPLM TSHPHHQHHH HHPPNSDSNS LFLPLPPTNN  60
QDQNHNSSSG SSMILDDHNN NNNSTNNNTG CYFMETNDGS SSSVKAKIMA HPHYHRLLAA  120
YVNCQKVGAP PEVVARLEEA CASAATMGPS GTGCLGEDPA LDQFMEAYCE MLTKYEQELS  180
KPFKEAMLFL QRVECQFKAL TVSSPSSACG EAADRNGSSE EEVDVNNNFI DPLAEDRELK  240
GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLDWWG RHYKWPYPSE SQKIALAEST  300
GLDQKQINNW FINQRKRHWK PSEDMQFVVM DATHPHYYMD NVLGNPFPMD LSPTLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253262LKQEFMKKRK
2259263KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026184.10.0KNOX/ELK homeobox transcription factor isoform 1
RefseqXP_007026185.10.0KNOX/ELK homeobox transcription factor isoform 1
SwissprotP466081e-164HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A061GI150.0A0A061GI15_THECC; KNOX/ELK homeobox transcription factor isoform 1
STRINGVIT_10s0116g00190.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64732644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-145KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]